hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080811/iprscan-20080811-09533146/chunk_1/iprscan-20080811-09533146.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fk10959
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00338                                                  36.2    4.3e-06   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00338    1/1     103   161 ..     1    65 []    36.2  4.3e-06

Alignments of top-scoring domains:
SM00338: domain 1 of 1, from 103 to 161: score 36.2, E = 4.3e-06
                   *->ekdeKrrrRrerNReAArrsReRKkayieeLedkveeLeaENesLrk
                      e   Kr+ R+++NReAAr +R++Kk+y++ Le +v+ Le++N++L +
     fk10959   103    EATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIE 149  

                   eleqLrreleklkselee<-*
                   el+ L+  +      +++   
     fk10959   150 ELKALKDLY------CHK    161  

//