hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20100628/iprscan-20100628-14192732/chunk_1/iprscan-20100628-14192732.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk11141 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01412.9.fs Putative GTPase activating protein for Arf 159.1 1.8e-45 1 PF01412.9.ls Putative GTPase activating protein for Arf 158.8 1.3e-44 1 PF08518.2.ls Spa2 homology domain (SHD) of GIT 137.6 3.2e-38 2 PF08518.2.fs Spa2 homology domain (SHD) of GIT 133.6 5.1e-37 2 PF00023.20.fs Ankyrin repeat 39.8 4e-10 3 PF00023.20.ls Ankyrin repeat 40.8 4.2e-09 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01412.9.ls 1/1 3 128 .. 1 137 [] 158.8 1.3e-44 PF01412.9.fs 1/1 7 128 .. 8 137 .] 159.1 1.8e-45 PF00023.20.fs 1/3 141 164 .. 6 29 .. 3.0 7.6 PF00023.20.fs 2/3 170 202 .. 1 33 [] 26.0 2.8e-06 PF00023.20.ls 1/2 170 202 .. 1 33 [] 28.0 3e-05 PF00023.20.fs 3/3 203 235 .. 1 33 [] 10.8 0.049 PF00023.20.ls 2/2 203 235 .. 1 33 [] 12.8 0.41 PF08518.2.ls 1/2 277 307 .. 1 31 [] 68.5 2e-17 PF08518.2.fs 1/2 277 307 .. 1 31 [] 66.5 7.9e-17 PF08518.2.ls 2/2 341 371 .. 1 31 [] 69.1 1.3e-17 PF08518.2.fs 2/2 341 371 .. 1 31 [] 67.1 5.4e-17 Alignments of top-scoring domains: PF01412.9.ls: domain 1 of 1, from 3 to 128: score 158.8, E = 1.3e-44 *->qrvlqlLrsldpgNkkCfDCgavpnPtWaSvnlGvflCieCSGiHRn l++ r+ + ++C+DC a p+P WaS++ Gv++C eC+++HR+ fk11141 3 ---LRMSRKGP-RAEVCADCSA-PDPGWASISRGVLVCDECCSVHRS 44 LfGvHiSkVnvRSltLDsWtpeelrklesckgGNenansfwEsnlddfsl L G+HiS V ++l++ +W+p+ l++++ + ++ans+wE+ l d++ fk11141 45 L-GRHISIV--KHLRHSAWPPTLLQMVH--TLASNGANSIWEHSLLDPAQ 89 kpkdsdaaa.v.KCqddrqkyesfiaaKYeeklfvlkeeqee<-* ++++ a++++K + ++++fi+aKY++++fv+k+++++ fk11141 90 VQSGRRKANpQdK---VHPIKSEFIRAKYQMLAFVHKLPCRD 128 PF01412.9.fs: domain 1 of 1, from 7 to 128: score 159.1, E = 1.8e-45 *->rsldpgNkkCfDCgavpnPtWaSvnlGvflCieCSGiHRnLfGvHiS r+ + ++C+DC a p+P WaS++ Gv++C eC+++HR+L G+HiS fk11141 7 RKGP-RAEVCADCSA-PDPGWASISRGVLVCDECCSVHRSL-GRHIS 50 kVnvRSltLDsWtpeelrklesckgGNenansfwEsnlddfslkpkdsda V ++l++ +W+p+ l++++ + ++ans+wE+ l d++ ++++ fk11141 51 IV--KHLRHSAWPPTLLQMVH--TLASNGANSIWEHSLLDPAQVQSGRRK 96 aa.v.KCqddrqkyesfiaaKYeeklfvlkeeqee<-* a++++K + ++++fi+aKY++++fv+k+++++ fk11141 97 ANpQdK---VHPIKSEFIRAKYQMLAFVHKLPCRD 128 PF00023.20.fs: domain 1 of 3, from 141 to 164: score 3.0, E = 7.6 *->LHlAalrgnlevvklLlsqGAdln<-* LH ++ gnle + Lls GA n fk11141 141 LHSSVRTGNLETCLRLLSLGAQAN 164 PF00023.20.fs: domain 2 of 3, from 170 to 202: score 26.0, E = 2.8e-06 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* G TPLH+Aa+ g++ ++lL+ +GAd+ d fk11141 170 KGTTPLHVAAKAGQTLQAELLVVYGADPGSPDV 202 PF00023.20.ls: domain 1 of 2, from 170 to 202: score 28.0, E = 3e-05 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* G TPLH+Aa+ g++ ++lL+ +GAd+ d fk11141 170 KGTTPLHVAAKAGQTLQAELLVVYGADPGSPDV 202 PF00023.20.fs: domain 3 of 3, from 203 to 235: score 10.8, E = 0.049 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +G+TP+ +A + g++e+++ L+++ +l + fk11141 203 NGRTPIDYARQAGHHELAERLVECQYELTDRLA 235 PF00023.20.ls: domain 2 of 2, from 203 to 235: score 12.8, E = 0.41 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +G+TP+ +A + g++e+++ L+++ +l + fk11141 203 NGRTPIDYARQAGHHELAERLVECQYELTDRLA 235 PF08518.2.ls: domain 1 of 2, from 277 to 307: score 68.5, E = 2e-17 *->akkKLarlsareFeeLviDvldevdRReqda<-* akkKL++ls+r+FeeL++Dv+devdRRe+da fk11141 277 AKKKLQALSNRLFEELAMDVYDEVDRRENDA 307 PF08518.2.fs: domain 1 of 2, from 277 to 307: score 66.5, E = 7.9e-17 *->akkKLarlsareFeeLviDvldevdRReqda<-* akkKL++ls+r+FeeL++Dv+devdRRe+da fk11141 277 AKKKLQALSNRLFEELAMDVYDEVDRRENDA 307 PF08518.2.ls: domain 2 of 2, from 341 to 371: score 69.1, E = 1.3e-17 *->akkKLarlsareFeeLviDvldevdRReqda<-* +++KLar++areF++L+iD+l+e++RR+q++ fk11141 341 GRQKLARFNAREFATLIIDILSEAKRRQQGK 371 PF08518.2.fs: domain 2 of 2, from 341 to 371: score 67.1, E = 5.4e-17 *->akkKLarlsareFeeLviDvldevdRReqda<-* +++KLar++areF++L+iD+l+e++RR+q++ fk11141 341 GRQKLARFNAREFATLIIDILSEAKRRQQGK 371 //