hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-10485852/chunk_1/iprscan-20080811-10485852.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk11476 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00168.20.fs C2 domain 54.9 8.9e-16 1 PF00168.20.ls C2 domain 56.8 6.5e-14 1 PF02845.6.fs CUE domain 48.5 8.9e-13 1 PF02845.6.ls CUE domain 47.6 3.8e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00168.20.fs 1/1 86 166 .. 1 88 [] 54.9 8.9e-16 PF00168.20.ls 1/1 86 166 .. 1 88 [] 56.8 6.5e-14 PF02845.6.fs 1/1 260 295 .. 1 36 [. 48.5 8.9e-13 PF02845.6.ls 1/1 260 302 .. 1 43 [] 47.6 3.8e-11 Alignments of top-scoring domains: PF00168.20.fs: domain 1 of 1, from 86 to 166: score 54.9, E = 8.9e-16 *->LrVtvieAknLppkDkkngksDPYVkvylggdkkdqkkkTkvikkt. L++tv++Ak ++ ++ +DPY++++lg ++ T ++++ fk11476 86 LNITVVQAKLAKNYG-MT-RMDPYCRLRLGY----AVYETPTAHNGa 126 lNPvWNEtFtFevpppdlqetLeieVyDydrfgrddflGevs<-* NP+WN + + + +pp +++ +e++D++ f+ dd + ++ fk11476 127 KNPRWNKVIHCT-VPPGVDS-FYLEIFDERAFSMDDRIAWTH 166 PF00168.20.ls: domain 1 of 1, from 86 to 166: score 56.8, E = 6.5e-14 *->LrVtvieAknLppkDkkngksDPYVkvylggdkkdqkkkTkvikkt. L++tv++Ak ++ ++ +DPY++++lg ++ T ++++ fk11476 86 LNITVVQAKLAKNYG-MT-RMDPYCRLRLGY----AVYETPTAHNGa 126 lNPvWNEtFtFevpppdlqetLeieVyDydrfgrddflGevs<-* NP+WN + + + +pp +++ +e++D++ f+ dd + ++ fk11476 127 KNPRWNKVIHCT-VPPGVDS-FYLEIFDERAFSMDDRIAWTH 166 PF02845.6.fs: domain 1 of 1, from 260 to 295: score 48.5, E = 8.9e-13 *->vneealhelkemFPqldksvIravLeantgnveati<-* + ee+l+++++mFP++d++vIr vLea++gn +a+i fk11476 260 CSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAI 295 PF02845.6.ls: domain 1 of 1, from 260 to 302: score 47.6, E = 3.8e-11 *->vneealhelkemFPqldksvIravLeantgnveatinnLLegs<-* + ee+l+++++mFP++d++vIr vLea++gn +a+i + L + fk11476 260 CSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAIPSHLVLG 302 //