hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080811/iprscan-20080811-10485852/chunk_1/iprscan-20080811-10485852.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fk11476
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00546                                                  45.6    6.6e-09   1
SM00239                                                  37.8    1.4e-06   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00239    1/1      85   182 ..     1    92 []    37.8  1.4e-06
SM00546    1/1     260   302 ..     1    43 []    45.6  6.6e-09

Alignments of top-scoring domains:
SM00239: domain 1 of 1, from 85 to 182: score 37.8, E = 1.4e-06
                   *->tLtvkiisArnLp.......DPYVkvs......kTkvvkktlsgfNP
                      +L++++++A+  ++ + ++ DPY++++ +     T +  +  +  NP
     fk11476    85    RLNITVVQAKLAKnygmtrmDPYCRLRlgyavyETPTAHNGAK--NP 129  

                   vWnEesetFeFevpp..s.LeieVyDk......dfiGrvtippnnahqhs
                   +Wn     ++ +vpp+ ++  +e++D++  + +d i  + i         
     fk11476   130 RWNK---VIHCTVPPgvDsFYLEIFDErafsmdDRIAWTHITI------- 169  

                   adglihlsell.ggrh.kl<-*
                          ++l++g   +k+   
     fk11476   170 ------PESLRqGKVEdKW    182  

SM00546: domain 1 of 1, from 260 to 302: score 45.6, E = 6.6e-09
                   *->eneealsqlkemFPnldeevIeavLeantgnveatinnLLegs<-*
                      + ee+l+++++mFPn+d+evI+ vLea++gn +a+i + L      
     fk11476   260    CSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAIPSHLVLG    302  

//