hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20090618/iprscan-20090618-13031431/chunk_1/iprscan-20090618-13031431.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fk11601
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00213                                                  88.6    7.6e-22   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00213    1/1      78   148 ..     1    72 []    88.6  7.6e-22

Alignments of top-scoring domains:
SM00213: domain 1 of 1, from 78 to 148: score 88.6, E = 7.6e-22
                   *->ieltvktldgektitlevkpsdwTVselKekiaelegiPpeqQrLiy
                      +e+ vktld+ +t t+ v  ++ +V+e+Ke+ia+   iP e+QrLiy
     fk11601    78    LEVLVKTLDS-QTRTFIVGAQM-NVKEFKEHIAASVSIPSEKQRLIY 122  

                   aGk.LeDd.tLaeygiqdgstihlvlr<-*
                   +G+ L+Dd+ L+ey+++   +ihlv r   
     fk11601   123 QGRvLQDDkKLQEYNVGGK-VIHLVER    148  

//