hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-13262909/chunk_1/iprscan-20080811-13262909.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk13658 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00010.16.fs Helix-loop-helix DNA-binding domain 50.9 5.7e-13 1 PF00010.16.ls Helix-loop-helix DNA-binding domain 52.9 9.9e-13 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00010.16.fs 1/1 65 117 .. 1 53 [] 50.9 5.7e-13 PF00010.16.ls 1/1 65 117 .. 1 53 [] 52.9 9.9e-13 Alignments of top-scoring domains: PF00010.16.fs: domain 1 of 1, from 65 to 117: score 50.9, E = 5.7e-13 *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve R +hn++E+ RR++++ +e+L++l+P +++s++ + ++ L++A fk13658 65 NRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKV 111 YIksLq<-* +Ik+L+ fk13658 112 HIKKLE 117 PF00010.16.ls: domain 1 of 1, from 65 to 117: score 52.9, E = 9.9e-13 *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve R +hn++E+ RR++++ +e+L++l+P +++s++ + ++ L++A fk13658 65 NRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKV 111 YIksLq<-* +Ik+L+ fk13658 112 HIKKLE 117 //