hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-14153764/chunk_1/iprscan-20080811-14153764.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk13968 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00581 124.9 8.9e-33 1 SM00513 36.9 2.8e-06 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00513 1/1 83 117 .. 1 35 [] 36.9 2.8e-06 SM00581 1/1 660 718 .. 1 62 [] 124.9 8.9e-33 Alignments of top-scoring domains: SM00513: domain 1 of 1, from 83 to 117: score 36.9, E = 2.8e-06 *->lskLkVseLkdeLkkrGLstsGrKaeLvkRLleal<-* + ++ +eL+++L ++G ++ G++ eLv+RL++++ fk13968 83 YGAWAAQELQAKLAEIGAPIQGNREELVERLQSYT 117 SM00581: domain 1 of 1, from 660 to 718: score 124.9, E = 8.9e-33 *->vkhfkPGrISdeLReALGlpeg.nafkqlPpWlyrMrrlGlidGyPP +k++kPG++SdeLR++LG+p g+na+k +PpWl++M+r+G +PP fk13968 660 LKEKKPGDLSDELRISLGMPVGpNAHKVPPPWLIAMQRYG----PPP 702 gYprlkIkglnapipl<-* +Yp+lkI+gln+pip+ fk13968 703 SYPNLKIPGLNSPIPE 718 //