hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-15450681/chunk_1/iprscan-20080811-15450681.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ha00462 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00385 84.1 1.7e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00385 1/1 150 234 .. 1 90 [] 84.1 1.7e-20 Alignments of top-scoring domains: SM00385: domain 1 of 1, from 150 to 234: score 84.1, E = 1.7e-20 *->dfLrrvakalnldpetlylAvnlldrfLseykvlkgyspsliAaaal +++ +v+++ ++++e+++lA+n+ldrfL ++ k +++l++a ++ ha00462 150 TWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPK-SHLQLLGAVCM 195 ylAsKteeip.pwtktlfhytgylppelayteeeilemekllle<-* +lAsK+ e+ + + + l+ yt++ + +++e+le+e+ +l ha00462 196 FLASKLKETSpLTAEKLCIYTDN-----SIKPQELLEWELVVLG 234 //