hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-18104068/chunk_1/iprscan-20080811-18104068.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ha01636 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00385 80.0 2.9e-19 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00385 1/1 86 170 .. 1 90 [] 80.0 2.9e-19 Alignments of top-scoring domains: SM00385: domain 1 of 1, from 86 to 170: score 80.0, E = 2.9e-19 *->dfLrrvakalnldpetlylAvnlldrfLseykvlkgyspsliAaaal ++ +v+++ ++++e+++lA+n+ldr+Ls+ ++ k ++l++a ++ ha01636 86 YWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRK-AQLQLLGAVCM 131 ylAsKteeip.pwtktlfhytgylppelayteeeilemekllle<-* +lAsK++e+++ +++ l+ yt+ a ++ +++++e l+l ha01636 132 LLASKLRETTpLTIEKLCIYTDH-----AVSPRQLRDWEVLVLG 170 //