hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-19005190/chunk_1/iprscan-20080811-19005190.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ha01907 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or 66.8 5.6e-18 1 PF00076.12.ls RNA recognition motif. (a.k.a. RRM, RBD, or 68.7 1.7e-17 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00076.12.fs 1/1 103 173 .. 1 74 [] 66.8 5.6e-18 PF00076.12.ls 1/1 103 173 .. 1 74 [] 68.7 1.7e-17 Alignments of top-scoring domains: PF00076.12.fs: domain 1 of 1, from 103 to 173: score 66.8, E = 5.6e-18 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV f gNLp+d+tee +k++F+ ++++r ++++ r kGf++ ha01907 103 AFLGNLPYDVTEESIKEFFRGLNIS-AVRLPR-EPSNPERLKGFGYA 147 eFedeedAekAldalnGkelggrelrv<-* eFed ++ +Al+ ln+ lg+r++rv ha01907 148 EFEDLDSLLSALS-LNEESLGNRRIRV 173 PF00076.12.ls: domain 1 of 1, from 103 to 173: score 68.7, E = 1.7e-17 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV f gNLp+d+tee +k++F+ ++++r ++++ r kGf++ ha01907 103 AFLGNLPYDVTEESIKEFFRGLNIS-AVRLPR-EPSNPERLKGFGYA 147 eFedeedAekAldalnGkelggrelrv<-* eFed ++ +Al+ ln+ lg+r++rv ha01907 148 EFEDLDSLLSALS-LNEESLGNRRIRV 173 //