hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-20153603/chunk_1/iprscan-20080811-20153603.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ha02793 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00501 119.0 5.3e-31 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00501 1/1 672 763 .. 1 95 [] 119.0 5.3e-31 Alignments of top-scoring domains: SM00501: domain 1 of 1, from 672 to 763: score 119.0, E = 5.3e-31 *->rerelFldrLykFmeergtpilkiPviggkpklDLyrLyrlVkerGG +er+ + dr+ +F ee + ++ +P++g+kp lDLyrLy+ Vke GG ha02793 672 PERKMWVDRYLAFTEEKAMGMTNLPAVGRKP-LDLYRLYVSVKEIGG 717 ydaVtkdkkWkeiaeelgipdtistsasssLrkhYlryLlpfEeflrg<- + +V+k+kkW+e+a+ l+ ++ s+sa+ssL+k+Y++ L++fE+ +++ ha02793 718 LTQVNKNKKWRELATNLNVGT--SSSAASSLKKQYIQCLYAFECKIER 763 * ha02793 - - //