hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-14172346/chunk_1/iprscan-20090618-14172346.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ha03243 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00319.9.fs SRF-type transcription factor (DNA-binding a 90.4 8.1e-25 1 PF00319.9.ls SRF-type transcription factor (DNA-binding a 92.4 1.3e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00319.9.fs 1/1 11 61 .. 1 51 [] 90.4 8.1e-25 PF00319.9.ls 1/1 11 61 .. 1 51 [] 92.4 1.3e-24 Alignments of top-scoring domains: PF00319.9.fs: domain 1 of 1, from 11 to 61: score 90.4, E = 8.1e-25 *->krIenksnrqVTfsKRrnGllKKAhELSVLCdaeVaviifsstGkly rI +++nrqVTf+KR+ Gl+KKA+ELSVLCd e+a+iif s++kl+ ha03243 11 TRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLF 57 eyss<-* y+s ha03243 58 QYAS 61 PF00319.9.ls: domain 1 of 1, from 11 to 61: score 92.4, E = 1.3e-24 *->krIenksnrqVTfsKRrnGllKKAhELSVLCdaeVaviifsstGkly rI +++nrqVTf+KR+ Gl+KKA+ELSVLCd e+a+iif s++kl+ ha03243 11 TRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLF 57 eyss<-* y+s ha03243 58 QYAS 61 //