hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20090618/iprscan-20090618-14172346/chunk_1/iprscan-20090618-14172346.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ha03243
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00432                                                 138.9    5.5e-37   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00432    1/1       3    62 ..     1    60 []   138.9  5.5e-37

Alignments of top-scoring domains:
SM00432: domain 1 of 1, from 3 to 62: score 138.9, E = 5.5e-37
                   *->MgRgKieIkrIeNktnRqVTFSKRRnGLfKKAhELSvLCDAeValIv
                      MgR+Ki+I rI +++nRqVTF+KR++GL+KKA+ELSvLCD+e+alI+
     ha03243     3    MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALII 49   

                   fSptGklyefasp<-*
                   f +++kl+++as+   
     ha03243    50 FNSSNKLFQYAST    62   

//