hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080811/iprscan-20080811-23125089/chunk_1/iprscan-20080811-23125089.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ha04849
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00292                                                  62.1    6.9e-14   2

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00292    1/2    1675  1850 ..     1    93 []    24.7    0.013
SM00292    2/2    1878  1966 ..     1    93 []    37.5  1.8e-06

Alignments of top-scoring domains:
SM00292: domain 1 of 2, from 1675 to 1850: score 24.7, E = 0.013
                   *->sklfkgltfvltGddiegkfd.e.rdelkeliealGGkvt.svsrk.
                      +++++g++  +t+   e   ++ +r      ++  G+    s+++++
     ha04849  1675    MGVLSGKRKLITS---EEERSpAkRGRKSATVKPVGAGEFvSPCESg 1718 

                   ..................................................
                   +++++++  ++++++ + +++   +     +  +++++  ++++ +++++
     ha04849  1719 dntgepsaleeqrgplplnktlflgyaflltmattsdklasrsklpdgpt 1768 

                   ......................................kl.pttthviv.
                   ++++++++  + ++ +++ ++++ + + +   ++ ++ +++  ++++++ 
     ha04849  1769 gsseeeeefleippfnkqytesqlragagyiledfneaQCnTAYQCLLIa 1818 

                   spegkkletdnrsst.kllkaialgipiVteeWlldclkkg<-*
                   + + +         t+k+++++a+gip+V++ W+ d++ ++   
     ha04849  1819 DQHCR---------TrKYFLCLASGIPCVSHVWVHDSCHAN    1850 

SM00292: domain 2 of 2, from 1878 to 1966: score 37.5, E = 1.8e-06
                   *->sklfkgltfvltGddiegkfd.e.rdelkeliealGGkvt.svsrk.
                      +++f++l++ l +       ++++  el + i + GG  + ++++++
     ha04849  1878    ENPFQNLKVLLVS------DQqQnFLELWSEILMTGGAASvKQHHSs 1918 

                   ....kl.pttthviv.spegkkletdnrsst.kllkaialgipiVteeWl
                    +++++   ++ v+v++p+ +         ++ l++a al +p+V+ eW+
     ha04849  1919 ahnkDIaLGVFDVVVtDPSCP---------AsVLKCAEALQLPVVSQEWV 1959 

                   ldclkkg<-*
                   ++cl  g   
     ha04849  1960 IQCLIVG    1966 

//