hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-23301701/chunk_1/iprscan-20080811-23301701.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ha06616 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00782.11.fs Dual specificity phosphatase, catalytic doma 111.1 1.1e-31 1 PF00782.11.ls Dual specificity phosphatase, catalytic doma 37.0 5.9e-08 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00782.11.fs 1/1 1 86 [. 82 173 .] 111.1 1.1e-31 PF00782.11.ls 1/1 1 86 [. 1 173 [] 37.0 5.9e-08 Alignments of top-scoring domains: PF00782.11.fs: domain 1 of 1, from 1 to 86: score 111.1, E = 1.1e-31 *->awnhetkiskylpeaveFIdkarqkggkVLVHCqAGiSRSAtliiAY a++++++++ ++ e+++FI+ +r +g+ +LVHC+AG+SRS+tl+iAY ha06616 1 ADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAY 47 LMktrnmslneAysfvyvYhikerRcpaisPNfgFlrQLleyerk<-* +M + ++A++ v + R ++ +PN+gF+rQL+e+e+ ha06616 48 IMTVTDFGWEDALHTV-----RAGR-SCANPNVGFQRQLQEFEKH 86 PF00782.11.ls: domain 1 of 1, from 1 to 86: score 37.0, E = 5.9e-08 *->gpveilphnlYLGsystasadlaflsklgItyviNvteevpnpfelc ha06616 1 ------------------A---------------------------- 1 kNdRhyteayflknsgilylriPhveDhIeYyhiawnhetkiskylpeav D +++++++ ++ e++ ha06616 2 --------------------------D---------SPSQNLTRHFKESI 16 eFIdkarqkggkVLVHCqAGiSRSAtliiAYLMktrnmslneAysfvyvY +FI+ +r +g+ +LVHC+AG+SRS+tl+iAY+M + ++A++ v ha06616 17 KFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTV--- 63 hikerRcpaisPNfgFlrQLleyerk<-* + R ++ +PN+gF+rQL+e+e+ ha06616 64 --RAGR-SCANPNVGFQRQLQEFEKH 86 //