hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080812/iprscan-20080812-00101902/chunk_1/iprscan-20080812-00101902.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: he00358
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model     Description                                   Score    E-value  N 
--------  -----------                                   -----    ------- ---
SM00443                                                  75.8    5.3e-18   1

Parsed for domains:
Model     Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------  ------- ----- -----    ----- -----      -----  -------
SM00443     1/1     149   195 ..     1    48 []    75.8  5.3e-18

Alignments of top-scoring domains:
SM00443: domain 1 of 1, from 149 to 195: score 75.8, E = 5.3e-18
                   *->istsniGaklLekMGWkeGkGLGkneqGivePIeakikkkdrkGLGa
                       +t++iG+klL+kMG+ +G+GLGkn qGi++PIeak + k ++ +Ga
     he00358   149    RHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR-KGKGAVGA 194  

                   v<-*
                   +   
     he00358   195 Y    195  

//