hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080812/iprscan-20080812-01430199/chunk_1/iprscan-20080812-01430199.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hg00715 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00401 66.6 3.2e-15 1 SM00717 37.5 1.8e-06 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00717 1/1 152 201 .. 1 53 [] 37.5 1.8e-06 SM00401 1/1 261 312 .. 1 54 [] 66.6 3.2e-15 Alignments of top-scoring domains: SM00717: domain 1 of 1, from 152 to 201: score 37.5, E = 1.8e-06 *->kkgeWteeEdelLleavkkyGkgtdndWakIakelp.gRtpkqcrer + Wte+E +++++++++yG +++ +I kel +++ +++ + hg00715 152 IEKCWTEDEVKRFVKGLRQYG----KNFFRIRKELLpNKETGELITF 194 wrnllkp<-* ++ ++k+ hg00715 195 YYYWKKT 201 SM00401: domain 1 of 1, from 261 to 312: score 66.6, E = 3.2e-15 *->kgsgrrCsnCgtttTplWRrgpsGnqktLCNACGLyykkhgvkkrpl +g++C +C ttt+++W++g++ n +LC++C++++kk+g+ ++p+ hg00715 261 ELKGYACRHCFTTTSKDWHHGGREN-ILLCTDCRIHFKKYGE-LPPI 305 slkkdgi<-* +++ d++ hg00715 306 EKPVDPP 312 //