hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20080812/iprscan-20080812-01490350/chunk_1/iprscan-20080812-01490350.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: hg00916
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or     33.6    1.1e-08   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PF00076.12.fs   1/1      48    78 ..    44    74 .]    33.6  1.1e-08

Alignments of top-scoring domains:
PF00076.12.fs: domain 1 of 1, from 48 to 78: score 33.6, E = 1.1e-08
                   *->faFVeFedeedAekAldalnGkelggrelrv<-*
                      +aFV +e+e dA++A+++lnGke++g+++ v   
     hg00916    48    YAFVHMEKEADAKAAIAQLNGKEVKGKRINV    78   

//