hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090630/iprscan-20090630-17375243/chunk_1/iprscan-20090630-17375243.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hg01394s1 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00321 297.2 1.2e-84 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00321 1/2 186 278 .. 1 103 [] 157.1 1.8e-42 SM00321 2/2 289 384 .. 1 103 [] 140.2 2.2e-37 Alignments of top-scoring domains: SM00321: domain 1 of 2, from 186 to 278: score 157.1, E = 1.8e-42 *->gatYvGCysdddvssrtlaakssyayhsSnmsveaCYqnfCaskGya + tY+GC+sdd+ ++rtl+++++y+ ++ m+v++C q++Ca+++y hg01394s1 186 RGTYIGCFSDDG-HERTLKGAVFYDLRK--MTVSHC-QDACAERSYV 228 lAaLengneCYCGdslpstsvsdeddssqCstkCsGplypaevCGGpsrl +A+Le+g+eCYCG++lp++sv ++C+++C+G ++++vCG+ +rl hg01394s1 229 YAGLEAGAECYCGNRLPAVSVG----LEECNHECKG--EKGSVCGAVDRL 272 svYvla<-* svY+ + hg01394s1 273 SVYRVD 278 SM00321: domain 2 of 2, from 289 to 384: score 140.2, E = 2.2e-37 *->gatYvGCysdddvssrtlaakssyayhsSnmsveaCYqnfCaskGya +atY+GC++ + +++t+a++ss+++++ ++v++C + fC++k+++ hg01394s1 289 TATYRGCFRLP--ENITHAFPSSLIQAN--VTVGTC-SGFCSQKEFP 330 lAaLengneCYCGdslpstsvsdeddssqCstkCsGplypaevCGGpsrl lA+L+ g+eCYC++++p+++++d++dss C+++++++ ++ae+C++++++ hg01394s1 331 LAILR-GWECYCAYPTPRFNLRDAMDSSVCGQDPEAQ-RLAEYCEVYQTP 378 svYvla<-* ++++++ hg01394s1 379 VQDTRC 384 //