hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20080812/iprscan-20080812-02245600/chunk_1/iprscan-20080812-02245600.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: hg01676
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model         Description                               Score    E-value  N 
--------      -----------                               -----    ------- ---
PF03098.6.fs  Animal haem peroxidase                     72.0    7.8e-20   1
PF00036.22.ls EF hand                                    58.8    1.6e-14   2
PF00036.22.fs EF hand                                    54.8    6.7e-14   2

Parsed for domains:
Model         Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------      ------- ----- -----    ----- -----      -----  -------
PF03098.6.fs    1/1      49   125 ..   538   619 .]    72.0  7.8e-20
PF00036.22.ls   1/2     385   413 ..     1    29 []    31.6  2.6e-06
PF00036.22.fs   1/2     385   413 ..     1    29 []    29.6  5.1e-07
PF00036.22.ls   2/2     421   449 ..     1    29 []    27.2  5.3e-05
PF00036.22.fs   2/2     421   449 ..     1    29 []    25.2    8e-06

Alignments of top-scoring domains:
PF03098.6.fs: domain 1 of 1, from 49 to 125: score 72.0, E = 7.8e-20
                   *->GgllEkpvpGglvGpTfaCIIgeQFsRlrrGDRFyYEngnnpgsFTp
                      GgllE+    g +Gp+f+ I+++QF Rlr+GDR+++En  ++g F++
     hg01676    49    GGLLES---HGDPGPLFSAIVLDQFVRLRDGDRYWFENT-RNGLFSK 91   

                   eQLaeiRKvsLsrliCdNtdevniervqpdaFsvp<-*
                   ++++ iR+++L ++++   + +   + qp++F++    
     hg01676    92 KEIEDIRNTTLRDVLVAVIN-IDPSALQPNVFVWH    125  

PF00036.22.ls: domain 1 of 2, from 385 to 413: score 31.6, E = 2.6e-06
                   *->elkeaFkefDkDgDGkIsfeEfkaalkkl<-*
                       ++ +F+++DkDg+G++sf Ef+++l  +   
     hg01676   385    FVESMFSLADKDGNGYLSFREFLDILVVF    413  

PF00036.22.fs: domain 1 of 2, from 385 to 413: score 29.6, E = 5.1e-07
                   *->elkeaFkefDkDgDGkIsfeEfkaalkkl<-*
                       ++ +F+++DkDg+G++sf Ef+++l  +   
     hg01676   385    FVESMFSLADKDGNGYLSFREFLDILVVF    413  

PF00036.22.ls: domain 2 of 2, from 421 to 449: score 27.2, E = 5.3e-05
                   *->elkeaFkefDkDgDGkIsfeEfkaalkkl<-*
                      + + +F ++D D +G++s++Ef ++++++   
     hg01676   421    KSRLMFTMYDLDENGFLSKDEFFTMMRSF    449  

PF00036.22.fs: domain 2 of 2, from 421 to 449: score 25.2, E = 8e-06
                   *->elkeaFkefDkDgDGkIsfeEfkaalkkl<-*
                      + + +F ++D D +G++s++Ef ++++++   
     hg01676   421    KSRLMFTMYDLDENGFLSKDEFFTMMRSF    449  

//