hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090630/iprscan-20090630-17441992/chunk_1/iprscan-20090630-17441992.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hg02120s1 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00324 243.6 1.6e-68 1 SM00055 69.2 5.3e-16 1 SM00326 64.4 1.4e-14 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00055 1/1 56 154 .. 1 103 [] 69.2 5.3e-16 SM00324 1/1 527 701 .. 1 193 [] 243.6 1.6e-68 SM00326 1/1 757 812 .. 1 58 [] 64.4 1.4e-14 Alignments of top-scoring domains: SM00055: domain 1 of 1, from 56 to 154: score 69.2, E = 5.3e-16 *->mgfwselwsddGfeaLlsrlknglrlledlkkflreRakiEeeYAkk ++++ +l +++f++L+++ ++ l+ll+dl++f+r++a+iE eY+++ hg02120s1 56 KEIRTQL--VEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRS 100 Lqklskkyfnkkssvgdlravreteselgslkkswevllsetdalakshl L kl++++++k + +++++++ l+++ ++w +l++t+++++ h hg02120s1 101 LEKLAERFSSKIR-SSREHQFKKDQYLLSPV-NCWYLVLHQTRRESRDHA 148 qlsedL<-* +l + + hg02120s1 149 TLNDIF 154 SM00324: domain 1 of 1, from 527 to 701: score 243.6, E = 1.6e-68 *->spiPiivekCieylekrGldteGIYRvsGsksrvkeLreafdsged. + iP++ve+Ci+y+ +Gl+++GI+Rv+Gs+ +v+ ++++f++ged+ hg02120s1 527 QAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDp 573 dldsldesiteesedleeydvhdvAglLKlyLReLPePLltfelyeefie + d +e+d+++vAg+LKly+R L +PL+++e ++++i+ hg02120s1 574 L-----------VDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDLIS 612 aaklyqieatsrkqseksedeeerlralrellslLPpanratLryLl.HL +kl e++ er+++++++l +LP++ ++ryL+ +L hg02120s1 613 TIKL--------------ENPAERVHQIQQILVTLPRVVIVVMRYLFaFL 648 nrVaehsevNkMtarNLAivFgPtLlrpp.....ltdikhqnkvvetlie n+++++s++N+M++ NLAi+FgPtL++ p++++++++ +h+n+v++t+i hg02120s1 649 NHLSQYSDENMMDPYNLAICFGPTLMHIPdgqdpVSCQAHINEVIKTIII 698 nad<-* +++ hg02120s1 699 HHE 701 SM00326: domain 1 of 1, from 757 to 812: score 64.4, E = 1.4e-14 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG +++A++Dy ++++ ELsFkkG +++ + +++WweG++n G G hg02120s1 757 IEAIAKFDYMGRSPRELSFKKGASLLLYHRASEDWWEGRHN--GVDG 801 lfPsnYVeeie<-* l+P+ Y+ +++ hg02120s1 802 LIPHQYIVVQD 812 //