hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080812/iprscan-20080812-04074487/chunk_1/iprscan-20080812-04074487.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hg04315 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00432.11.fs Prenyltransferase and squalene oxidase re 267.9 1.9e-77 5 PF00432.11.ls Prenyltransferase and squalene oxidase re 260.1 4.2e-75 5 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00432.11.fs 1/5 66 109 .. 1 45 [] 52.7 1.5e-14 PF00432.11.ls 1/5 66 109 .. 1 45 [] 54.7 2.9e-13 PF00432.11.ls 2/5 114 157 .. 1 45 [] 66.1 1.1e-16 PF00432.11.fs 2/5 114 157 .. 1 45 [] 64.1 7.3e-18 PF00432.11.fs 3/5 162 205 .. 1 45 [] 64.1 7.1e-18 PF00432.11.ls 3/5 162 205 .. 1 45 [] 66.1 1.1e-16 PF00432.11.fs 4/5 210 253 .. 1 45 [] 56.3 1.3e-15 PF00432.11.ls 4/5 210 253 .. 1 45 [] 58.3 2.3e-14 PF00432.11.fs 5/5 258 290 .. 1 33 [. 30.7 4.3e-08 Alignments of top-scoring domains: PF00432.11.fs: domain 1 of 5, from 66 to 109: score 52.7, E = 1.5e-14 *->idkeklvdyllscQnpdGGfggrpggcesdtyytycalaaLallg<- +++e+++ +++scQ++ GG + ++g+ ++++ yt+ a+++L l++ hg04315 66 MNREEILAFIKSCQHECGGISASIGH-DPHLLYTLSAVQILTLYD 109 * hg04315 - - PF00432.11.ls: domain 1 of 5, from 66 to 109: score 54.7, E = 2.9e-13 *->idkeklvdyllscQnpdGGfggrpggcesdtyytycalaaLallg<- +++e+++ +++scQ++ GG + ++g+ ++++ yt+ a+++L l++ hg04315 66 MNREEILAFIKSCQHECGGISASIGH-DPHLLYTLSAVQILTLYD 109 * hg04315 - - PF00432.11.ls: domain 2 of 5, from 114 to 157: score 66.1, E = 1.1e-16 *->idkeklvdyllscQnpdGGfggrpggcesdtyytycalaaLallg<- id++k+v+y+++ Q +dG+f+g+++g e dt++++ca+a+Lallg hg04315 114 IDVNKVVEYVKGLQKEDGSFAGDIWG-EIDTRFSFCAVATLALLG 157 * hg04315 - - PF00432.11.fs: domain 2 of 5, from 114 to 157: score 64.1, E = 7.3e-18 *->idkeklvdyllscQnpdGGfggrpggcesdtyytycalaaLallg<- id++k+v+y+++ Q +dG+f+g+++g e dt++++ca+a+Lallg hg04315 114 IDVNKVVEYVKGLQKEDGSFAGDIWG-EIDTRFSFCAVATLALLG 157 * hg04315 - - PF00432.11.fs: domain 3 of 5, from 162 to 205: score 64.1, E = 7.1e-18 *->idkeklvdyllscQnpdGGfggrpggcesdtyytycalaaLallg<- i++ek+++++lsc+n+dGGfg+rpg+ es++++ yc+++ La++ hg04315 162 INVEKAIEFVLSCMNFDGGFGCRPGS-ESHAGQIYCCTGFLAITS 205 * hg04315 - - PF00432.11.ls: domain 3 of 5, from 162 to 205: score 66.1, E = 1.1e-16 *->idkeklvdyllscQnpdGGfggrpggcesdtyytycalaaLallg<- i++ek+++++lsc+n+dGGfg+rpg+ es++++ yc+++ La++ hg04315 162 INVEKAIEFVLSCMNFDGGFGCRPGS-ESHAGQIYCCTGFLAITS 205 * hg04315 - - PF00432.11.fs: domain 4 of 5, from 210 to 253: score 56.3, E = 1.3e-15 *->idkeklvdyllscQnpdGGfggrpggcesdtyytycalaaLallg<- + + l ++l+ +Q+p+GG++grp++ +d++y++++la+L+++g hg04315 210 VNSDLLGWWLCERQLPSGGLNGRPEK-LPDVCYSWWVLASLKIIG 253 * hg04315 - - PF00432.11.ls: domain 4 of 5, from 210 to 253: score 58.3, E = 2.3e-14 *->idkeklvdyllscQnpdGGfggrpggcesdtyytycalaaLallg<- + + l ++l+ +Q+p+GG++grp++ +d++y++++la+L+++g hg04315 210 VNSDLLGWWLCERQLPSGGLNGRPEK-LPDVCYSWWVLASLKIIG 253 * hg04315 - - PF00432.11.fs: domain 5 of 5, from 258 to 290: score 30.7, E = 4.3e-08 *->idkeklvdyllscQn.pdGGfggrpggcesdtyy<-* id+ekl++++l cQ+++ GGf++rpg+ + + y+ hg04315 258 IDREKLRNFILACQDeETGGFADRPGD-MHFIYQ 290 //