hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20080812/iprscan-20080812-05442041/chunk_1/iprscan-20080812-05442041.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: hh00902
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model     Description                                   Score    E-value  N 
--------  -----------                                   -----    ------- ---
PF01387.8.fs Synuclein                                      26.7    2.3e-07   1

Parsed for domains:
Model     Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------  ------- ----- -----    ----- -----      -----  -------
PF01387.8.fs   1/1      46    78 ..   116   148 .]    26.7  2.3e-07

Alignments of top-scoring domains:
PF01387.8.fs: domain 1 of 1, from 46 to 78: score 26.7, E = 2.3e-07
                   *->keEevpqeeveeskekplvePeeEayEepeeeg<-*
                      ++Eev+qe++ee++++pl+ePe+E+yE+p++     
     hh00902    46    QPEEVAQEAAEEPLIEPLMEPEGESYEDPPQVR    78   

//