hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080812/iprscan-20080812-06511682/chunk_1/iprscan-20080812-06511682.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hh01845 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF04379.5.ls Protein of unknown function (DUF525) 271.6 1.4e-78 1 PF04379.5.fs Protein of unknown function (DUF525) 269.6 5.7e-78 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF04379.5.fs 1/1 253 379 .. 1 138 [] 269.6 5.7e-78 PF04379.5.ls 1/1 253 379 .. 1 138 [] 271.6 1.4e-78 Alignments of top-scoring domains: PF04379.5.fs: domain 1 of 1, from 253 to 379: score 269.6, E = 5.7e-78 *->rattrdIeVrVspfYlpeqSnpeeqrYvfaYtItIeNSlmPEGCiLN +att+dI+V+Vs+++lpe S++++++Y+f+Y+I+Ie+S++ hh01845 253 VATTGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKD------- 292 glgevsvQLlsRhWrITdgnGrveeVrGeGVVGeQPlLsPGeeeyqYtSg +l+e+++QL+sR+WrIT+++G+veeV+G+GVVGe+P++sPG ++y+YtS+ hh01845 293 ALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPG-RVYEYTSC 341 vsLdTpsGsMqGhYTFVPgqMldedGetFdVaIPpFsLavP<-* ++++T+sG+M+G+YT +++l++++++F+VaIP+F++a+P hh01845 342 TTFSTTSGYMEGYYT---FHFLYFKDKIFNVAIPRFHMACP 379 PF04379.5.ls: domain 1 of 1, from 253 to 379: score 271.6, E = 1.4e-78 *->rattrdIeVrVspfYlpeqSnpeeqrYvfaYtItIeNSlmPEGCiLN +att+dI+V+Vs+++lpe S++++++Y+f+Y+I+Ie+S++ hh01845 253 VATTGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKD------- 292 glgevsvQLlsRhWrITdgnGrveeVrGeGVVGeQPlLsPGeeeyqYtSg +l+e+++QL+sR+WrIT+++G+veeV+G+GVVGe+P++sPG ++y+YtS+ hh01845 293 ALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPG-RVYEYTSC 341 vsLdTpsGsMqGhYTFVPgqMldedGetFdVaIPpFsLavP<-* ++++T+sG+M+G+YT +++l++++++F+VaIP+F++a+P hh01845 342 TTFSTTSGYMEGYYT---FHFLYFKDKIFNVAIPRFHMACP 379 //