hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080812/iprscan-20080812-07214998/chunk_1/iprscan-20080812-07214998.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: hh02276
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00248                                                  45.3    8.2e-09   3

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00248    1/3     107   145 ..     1    30 []     8.9    3e+02
SM00248    2/3     150   181 ..     1    30 []    18.0      1.3
SM00248    3/3     187   216 ..     1    30 []    18.4     0.99

Alignments of top-scoring domains:
SM00248: domain 1 of 3, from 107 to 145: score 8.9, E = 3e+02
                   *->dGrTpLHlAaen.........gnlevvklLldkgadina<-*
                       ++T LH+ ++++ ++ ++ +  ++++  L+d gadi +   
     hh02276   107    TDMTLLHYTCKSgahgigdveTAVKFATQLIDLGADISL    145  

SM00248: domain 2 of 3, from 150 to 181: score 18.0, E = 1.3
                   *->dGrTpLHlAaengnlevvklLldkga..dina<-*
                       ++++LH+Aa+ + +e+++ +l+ + ++d++a   
     hh02276   150    TNMNALHYAAYFDVPELIRVILKTSKpkDVDA    181  

SM00248: domain 3 of 3, from 187 to 216: score 18.4, E = 0.99
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                      +  T+LH+Aa+n     vk+Ll+ ga++     
     hh02276   187    NFGTALHIAAYNLCAGAVKCLLEQGANPAF    216  

//