hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-15135079/chunk_1/iprscan-20090618-15135079.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hh04063 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00382 34.9 1.1e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00382 1/1 516 702 .. 1 92 [] 34.9 1.1e-05 Alignments of top-scoring domains: SM00382: domain 1 of 1, from 516 to 702: score 34.9, E = 1.1e-05 *->pgevvllvGppGsGKTTlaralarllgp..gviyidge......... g ++l++Gp+G+GK+ l r l +l + +gv+y ++++ ++ hh04063 516 EGMHLLITGPNGCGKSSLFRILSGLWPVyeGVLYKPPPqhmfyipqr 562 .................................................. + ++ +++ ++ ++ ++++ +++ ++ ++ + + +++++ hh04063 563 pymslgslrdqviypdsvddmhdkgytdqdlerilhnvhlyhivqreggw 612 ...........ggqrirlalalark...dvlllDEitslld......... + + ++ +gg+++r +a++ +++++ llDE ts+ + +++ + hh04063 613 davmdwkdvlsGGEKQRMGMARMFYhkpKYALLDECTSAVSidvegkifq 662 ......vtviattn.....dldpallrrrfdrrivllril<-* ++ +++++ +t++++ +ll + + +++ + hh04063 663 aakgagISLLSITHrpslwKYHTHLLQFDGEGGWRFEQLD 702 //