hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080812/iprscan-20080812-08461213/chunk_1/iprscan-20080812-08461213.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: hh04944
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00291                                                  74.1    1.7e-17   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00291    1/1     248   293 ..     1    46 []    74.1  1.7e-17

Alignments of top-scoring domains:
SM00291: domain 1 of 1, from 248 to 293: score 74.1, E = 1.7e-17
                   *->vhhsvsCdgCgkepivgvRYkClvCpDYDLCesCfakGghhgeHam<
                      v+h v C++C++e ++g+RY+C++C++Y+LC++Cf+ G+++g+H++ 
     hh04944   248    VFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSN  293  

                   -*
                     
     hh04944     -    -    

//