hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080812/iprscan-20080812-09572944/chunk_1/iprscan-20080812-09572944.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hh07616 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02373.13.fs JmjC domain 39.3 3.4e-11 1 PF02373.13.ls JmjC domain 6.6 0.00016 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02373.13.ls 1/1 1104 1212 .. 1 126 [] 6.6 0.00016 PF02373.13.fs 1/1 1172 1212 .. 86 126 .] 39.3 3.4e-11 Alignments of top-scoring domains: PF02373.13.ls: domain 1 of 1, from 1104 to 1212: score 6.6, E = 0.00016 *->wlYvGmpfSttpwHiEdqglySinylhfgapkvWYgiPseyaekfek +++++ w ++q + +++ f+a++ + ++f hh07616 1104 KDFLSGLDGEGLWSPGSQVST--VWHVFRAQD------AQRIRRFL- 1141 lakvlskhfsaPdlnggeqpdldlrhlvtlisPkvleLrengipvyrfvQ +++ + + a l + p+ +l+ + + + +e+g+ +++ +Q hh07616 1142 --QMVCPAG-AGAL-EPGAPG--SCYLDAGLRRRL--REEWGVSCWTLLQ 1183 kpGEfVitfPgayHavfNlGfniaeavNF<-* pGE+V +++ga+H+v+ l ++++++++F hh07616 1184 APGEAVLVPAGAPHQVQGLVSTVSVTQHF 1212 PF02373.13.fs: domain 1 of 1, from 1172 to 1212: score 39.3, E = 3.4e-11 *->rengipvyrfvQkpGEfVitfPgayHavfNlGfniaeavNF<-* +e+g+ +++ +Q pGE+V +++ga+H+v+ l ++++++++F hh07616 1172 EEWGVSCWTLLQAPGEAVLVPAGAPHQVQGLVSTVSVTQHF 1212 //