hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-15200238/chunk_1/iprscan-20090618-15200238.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hh09742 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00088 93.8 2.1e-23 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00088 1/1 327 417 .. 1 92 [] 93.8 2.1e-23 Alignments of top-scoring domains: SM00088: domain 1 of 1, from 327 to 417: score 93.8, E = 2.1e-23 *->qhverLqrkiretnllqlsepYPssislsdlakllglsvpeevEklv +v ++++ ++++n+++l++++ ++sl+d+a+ ++ls p+e+Ek+v hh09742 327 GLVKQCLSSLYKKNIQRLTKTF-LTLSLQDMASRVQLSGPQEAEKYV 372 skaIrdgeisakIDqvngivefeevdpryltsnqlaqlaerlkkl<-* + +I+dgei a+I+q++g+v+f+++++ y+++ +l+++++ +k+ hh09742 373 LHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKC 417 //