hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090630/iprscan-20090630-18003128/chunk_1/iprscan-20090630-18003128.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hh11961s1 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00439.15.ls Bromodomain 127.8 2.8e-35 1 PF00439.15.fs Bromodomain 125.9 6.1e-35 1 PF00628.19.fs PHD-finger 36.6 2.5e-11 2 PF00628.19.ls PHD-finger 33.9 5e-07 1 PF00855.8.fs PWWP domain 23.8 1.6e-06 2 PF00855.8.ls PWWP domain 11.1 0.00089 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00628.19.ls 1/1 223 271 .. 1 51 [] 33.9 5e-07 PF00628.19.fs 1/2 223 271 .. 1 51 [] 32.0 7.2e-10 PF00439.15.fs 1/1 603 690 .. 1 92 [] 125.9 6.1e-35 PF00439.15.ls 1/1 603 690 .. 1 92 [] 127.8 2.8e-35 PF00855.8.fs 1/2 1082 1108 .. 1 27 [. 20.9 1.1e-05 PF00855.8.ls 1/1 1082 1182 .. 1 86 [] 11.1 0.00089 Alignments of top-scoring domains: PF00628.19.ls: domain 1 of 1, from 223 to 271: score 33.9, E = 5e-07 *->yCsvCgkeysdaggdllqCDgCdrwfHlaClgpplepeeipeWyCpe +C+vC + + ++ + +l+CD C+ ++H++C+g p pe++ W+C+ hh11961s1 223 FCCVCLDDECHNSNVILFCDICNLAVHQECYGVPYIPEGQ--WLCRC 267 Ckpk<-* C + hh11961s1 268 CLQS 271 PF00628.19.fs: domain 1 of 2, from 223 to 271: score 32.0, E = 7.2e-10 *->yCsvCgkeysdaggdllqCDgCdrwfHlaClgpplepeeipeWyCpe +C+vC + + ++ + +l+CD C+ ++H++C+g p pe++ W+C+ hh11961s1 223 FCCVCLDDECHNSNVILFCDICNLAVHQECYGVPYIPEGQ--WLCRC 267 Ckpk<-* C + hh11961s1 268 CLQS 271 PF00439.15.fs: domain 1 of 1, from 603 to 690: score 125.9, E = 6.1e-35 *->lnklllkvlealdehgpralpflfpVlpsklelPDYYeiIkkPMDLk +n ll+++l+ l+e++ a f +pV+ s e+PDY e+I kPMD++ hh11961s1 603 FNVLLRTTLDLLQEKD-PAHIFAEPVNLS--EVPDYLEFISKPMDFS 646 TIkkklkngkYissleeFvaDfnLmfsNAktYNepdsevykdAkk<-* T+++kl+++ Y ++leeF++DfnL+++N+++YN +d++++++A++ hh11961s1 647 TMRRKLESHLY-RTLEEFEEDFNLIVTNCMKYNAKDTIFHRAAVR 690 PF00439.15.ls: domain 1 of 1, from 603 to 690: score 127.8, E = 2.8e-35 *->lnklllkvlealdehgpralpflfpVlpsklelPDYYeiIkkPMDLk +n ll+++l+ l+e++ a f +pV+ s e+PDY e+I kPMD++ hh11961s1 603 FNVLLRTTLDLLQEKD-PAHIFAEPVNLS--EVPDYLEFISKPMDFS 646 TIkkklkngkYissleeFvaDfnLmfsNAktYNepdsevykdAkk<-* T+++kl+++ Y ++leeF++DfnL+++N+++YN +d++++++A++ hh11961s1 647 TMRRKLESHLY-RTLEEFEEDFNLIVTNCMKYNAKDTIFHRAAVR 690 PF00855.8.fs: domain 1 of 2, from 1082 to 1108: score 20.9, E = 1.1e-05 *->dfkpGDLVwAKmkGFpwWPArvvsqke<-* d+kp +LVwAK +G+p PA+++++k+ hh11961s1 1082 DLKPLELVWAKCRGYPSYPALIIDPKM 1108 PF00855.8.ls: domain 1 of 1, from 1082 to 1182: score 11.1, E = 0.00089 *->dfkpGDLVwAKmkGFpwWPArvvsqketptsvrkkLKRn........ d+kp +LVwAK +G+p PA+++++k+ r+ L n+ + + ++ hh11961s1 1082 DLKPLELVWAKCRGYPSYPALIIDPKMP----REGLLHNgvpipvpp 1124 ..........tnsrksnrvkVqFFgdhkyrawvskkrlkPlLdsd..iek + + ++++ + + + V+FF+ + w++++++ Pl +++++ +k hh11961s1 1125 ldvlklgeqkQAEAGEKLFLVLFFDNKRTWQWLPRDKVLPL-GVEdtVDK 1173 fhkdekrKg<-* ++ e rK+ hh11961s1 1174 LKMLEGRKT 1182 //