hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090525/iprscan-20090525-17033637/chunk_1/iprscan-20090525-17033637.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hh13727 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00096.16.ls Zinc finger, C2H2 type 311.5 1.4e-90 9 PF00096.16.fs Zinc finger, C2H2 type 293.8 3.1e-85 9 PF01352.17.fs KRAB box 89.9 6.4e-25 1 PF01352.17.ls KRAB box 90.9 3.6e-24 1 PF01096.9.fs Transcription factor S-II (TFIIS) 52.0 2.1e-15 9 PF04032.6.fs RNAse P Rpr2/Rpp21/SNM1 subunit domain 21.5 2.8e-06 6 PF08792.1.fs A2L zinc ribbon domain 20.5 0.0002 8 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01352.17.fs 1/1 42 80 .. 3 41 .] 89.9 6.4e-25 PF01352.17.ls 1/1 42 80 .. 1 41 [] 90.9 3.6e-24 PF00096.16.fs 1/9 233 255 .. 1 24 [] 26.9 1.9e-05 PF00096.16.ls 1/9 233 255 .. 1 24 [] 28.8 1.7e-05 PF00096.16.ls 2/9 261 283 .. 1 24 [] 34.3 4e-07 PF00096.16.fs 2/9 261 283 .. 1 24 [] 32.3 8.4e-07 PF00096.16.ls 3/9 289 311 .. 1 24 [] 38.6 2e-08 PF00096.16.fs 3/9 289 311 .. 1 24 [] 36.6 7e-08 PF00096.16.ls 4/9 317 339 .. 1 24 [] 35.3 1.9e-07 PF00096.16.fs 4/9 317 339 .. 1 24 [] 33.3 4.6e-07 PF00096.16.ls 5/9 345 367 .. 1 24 [] 35.3 2e-07 PF00096.16.fs 5/9 345 367 .. 1 24 [] 33.3 4.7e-07 PF00096.16.fs 6/9 373 395 .. 1 24 [] 35.1 1.7e-07 PF00096.16.ls 6/9 373 395 .. 1 24 [] 37.0 5.9e-08 PF00096.16.fs 7/9 401 423 .. 1 24 [] 35.7 1.2e-07 PF00096.16.ls 7/9 401 423 .. 1 24 [] 37.7 3.8e-08 PF00096.16.fs 8/9 429 451 .. 1 24 [] 31.6 1.2e-06 PF00096.16.ls 8/9 429 451 .. 1 24 [] 33.6 6.3e-07 PF00096.16.fs 9/9 457 479 .. 1 24 [] 28.9 6e-06 PF00096.16.ls 9/9 457 479 .. 1 24 [] 30.8 4.3e-06 Alignments of top-scoring domains: PF01352.17.fs: domain 1 of 1, from 42 to 80: score 89.9, E = 6.4e-25 *->FeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-* F+DVa+ F+qEEW++L paQr+LYrdVMlE+ysnLvSlg hh13727 42 FRDVAIVFSQEEWQWLAPAQRDLYRDVMLETYSNLVSLG 80 PF01352.17.ls: domain 1 of 1, from 42 to 80: score 90.9, E = 3.6e-24 *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-* F+DVa+ F+qEEW++L paQr+LYrdVMlE+ysnLvSlg hh13727 42 --FRDVAIVFSQEEWQWLAPAQRDLYRDVMLETYSNLVSLG 80 PF00096.16.fs: domain 1 of 9, from 233 to 255: score 26.9, E = 1.9e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* ykC+ +Cgk+F+ s L +H ++H hh13727 233 YKCK-ECGKAFKYGSRLIQHENIH 255 PF00096.16.ls: domain 1 of 9, from 233 to 255: score 28.8, E = 1.7e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* ykC+ +Cgk+F+ s L +H ++H hh13727 233 YKCK-ECGKAFKYGSRLIQHENIH 255 PF00096.16.ls: domain 2 of 9, from 261 to 283: score 34.3, E = 4e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F++ sn+ +H+r+H hh13727 261 YECK-ECGKAFNSGSNFIQHQRVH 283 PF00096.16.fs: domain 2 of 9, from 261 to 283: score 32.3, E = 8.4e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F++ sn+ +H+r+H hh13727 261 YECK-ECGKAFNSGSNFIQHQRVH 283 PF00096.16.ls: domain 3 of 9, from 289 to 311: score 38.6, E = 2e-08 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ dC k+Fsr+s+L H+rtH hh13727 289 YECK-DCEKAFSRSSQLIEHQRTH 311 PF00096.16.fs: domain 3 of 9, from 289 to 311: score 36.6, E = 7e-08 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ dC k+Fsr+s+L H+rtH hh13727 289 YECK-DCEKAFSRSSQLIEHQRTH 311 PF00096.16.ls: domain 4 of 9, from 317 to 339: score 35.3, E = 1.9e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F+r s+Lk H r+H hh13727 317 YQCK-ECGKAFNRISHLKVHYRIH 339 PF00096.16.fs: domain 4 of 9, from 317 to 339: score 33.3, E = 4.6e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F+r s+Lk H r+H hh13727 317 YQCK-ECGKAFNRISHLKVHYRIH 339 PF00096.16.ls: domain 5 of 9, from 345 to 367: score 35.3, E = 2e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y C+ +Cgk+Fs++s+L +H+ +H hh13727 345 YACK-ECGKTFSHRSQLIQHQTVH 367 PF00096.16.fs: domain 5 of 9, from 345 to 367: score 33.3, E = 4.7e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y C+ +Cgk+Fs++s+L +H+ +H hh13727 345 YACK-ECGKTFSHRSQLIQHQTVH 367 PF00096.16.fs: domain 6 of 9, from 373 to 395: score 35.1, E = 1.7e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F++ s+L rH+r+H hh13727 373 YECK-ECGKAFNQGSTLIRHQRIH 395 PF00096.16.ls: domain 6 of 9, from 373 to 395: score 37.0, E = 5.9e-08 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F++ s+L rH+r+H hh13727 373 YECK-ECGKAFNQGSTLIRHQRIH 395 PF00096.16.fs: domain 7 of 9, from 401 to 423: score 35.7, E = 1.2e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F+ +s+Lk+H+r+H hh13727 401 YECK-VCGKAFRVSSQLKQHQRIH 423 PF00096.16.ls: domain 7 of 9, from 401 to 423: score 37.7, E = 3.8e-08 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+F+ +s+Lk+H+r+H hh13727 401 YECK-VCGKAFRVSSQLKQHQRIH 423 PF00096.16.fs: domain 8 of 9, from 429 to 451: score 31.6, E = 1.2e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cg++F+r s+L+ H r+H hh13727 429 YQCK-VCGRAFKRVSHLTVHYRIH 451 PF00096.16.ls: domain 8 of 9, from 429 to 451: score 33.6, E = 6.3e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cg++F+r s+L+ H r+H hh13727 429 YQCK-VCGRAFKRVSHLTVHYRIH 451 PF00096.16.fs: domain 9 of 9, from 457 to 479: score 28.9, E = 6e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+Fs+ s+L +H+ +H hh13727 457 YECK-ECGKAFSHCSQLIHHQVIH 479 PF00096.16.ls: domain 9 of 9, from 457 to 479: score 30.8, E = 4.3e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+Fs+ s+L +H+ +H hh13727 457 YECK-ECGKAFSHCSQLIHHQVIH 479 //