hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/TIGRFAMs_HMM.LIB.bin Sequence file: /db/iprscan/tmp/20080812/iprscan-20080812-13453137/chunk_1/iprscan-20080812-13453137.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hj01066 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TIGR00003 TIGR00003: copper ion binding protein 166.0 3.1e-47 6 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TIGR00003 1/6 19 84 .. 1 66 [] 59.2 4.5e-15 TIGR00003 5/6 499 564 .. 1 66 [] 32.9 3.3e-07 Alignments of top-scoring domains: TIGR00003: domain 1 of 6, from 19 to 84: score 59.2, E = 4.5e-15 *->KktfqVkGMsCnHCVdkIEkfVGEleGVSavkVqLeKekVvVeFDap +t++V+GM+Cn CV IE +G GV +kV+Le + + + D hj01066 19 SVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPK 65 kvsakeIkeAIlDaGYeve<-* + k +eAI D G++++ hj01066 66 LQTPKTLQEAIDDMGFDAV 84 TIGR00003: domain 5 of 6, from 499 to 564: score 32.9, E = 3.3e-07 *->KktfqVkGMsCnHCVdkIEkfVGEleGVSavkVqLeKekVvVeFDap K +qV GM+C CV+ IE + eG+ + V L ++k+ V + hj01066 499 KCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPA 545 kvsakeIkeAIlDaGYeve<-* + I+e I ++G+ + hj01066 546 VIQPPMIAEFIRELGFGAT 564 //