hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080812/iprscan-20080812-13572517/chunk_1/iprscan-20080812-13572517.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hj01412 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07645.6.ls Calcium binding EGF domain 581.9 5.5e-172 15 PF07645.6.fs Calcium binding EGF domain 561.5 6.7e-170 16 PF00008.17.ls EGF-like domain 330.6 2.6e-96 16 PF00008.17.fs EGF-like domain 318.1 1.4e-92 15 PF00683.8.fs TB domain 272.8 3.4e-85 4 PF00683.8.ls TB domain 276.0 6.9e-80 4 PF01826.8.fs Trypsin Inhibitor like cysteine rich domain 87.7 1.4e-27 14 PF07974.3.fs EGF-like domain 65.8 2.3e-17 11 PF07974.3.ls EGF-like domain 58.5 2e-14 10 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00008.17.fs 1/15 83 110 .. 1 38 [] 28.7 4e-07 PF00008.17.ls 1/16 83 110 .. 1 38 [] 30.4 6e-06 PF07974.3.ls 1/10 83 110 .. 1 37 [] 21.2 0.0035 PF00683.8.ls 1/4 246 289 .. 1 45 [] 56.5 8.3e-14 PF00683.8.fs 1/4 246 289 .. 1 45 [] 54.5 1.8e-16 PF07645.6.fs 2/16 306 345 .. 1 55 [] 39.1 4e-11 PF07645.6.ls 1/15 306 345 .. 1 55 [] 40.9 4.1e-09 PF00683.8.ls 2/4 367 408 .. 1 45 [] 65.1 2e-16 PF00683.8.fs 2/4 367 403 .. 1 40 [. 67.8 1.2e-20 PF00008.17.ls 3/16 504 540 .. 1 38 [] 32.7 1.2e-06 PF00008.17.fs 3/15 504 540 .. 1 38 [] 30.7 1e-07 PF07645.6.ls 3/15 542 582 .. 1 55 [] 55.4 1.7e-13 PF07645.6.fs 4/16 542 582 .. 1 55 [] 53.7 1.5e-15 PF00008.17.fs 4/15 546 582 .. 1 38 [] 25.7 2.7e-06 PF00008.17.ls 4/16 546 582 .. 1 38 [] 27.7 3.8e-05 PF07645.6.fs 5/16 584 623 .. 1 55 [] 42.3 4.2e-12 PF07645.6.ls 4/15 584 623 .. 1 55 [] 44.1 4.5e-10 PF07645.6.fs 6/16 625 663 .. 1 55 [] 39.1 4.1e-11 PF07645.6.ls 5/15 625 663 .. 1 55 [] 40.8 4.3e-09 PF07645.6.fs 7/16 665 704 .. 1 55 [] 43.5 1.9e-12 PF07645.6.ls 6/15 665 704 .. 1 55 [] 45.2 2.1e-10 PF00008.17.ls 6/16 669 704 .. 1 38 [] 19.5 0.011 PF07645.6.ls 7/15 706 745 .. 1 55 [] 42.4 1.4e-09 PF07645.6.fs 8/16 706 745 .. 1 55 [] 40.7 1.4e-11 PF00008.17.ls 7/16 710 745 .. 1 38 [] 22.9 0.001 PF07645.6.fs 9/16 747 786 .. 1 55 [] 53.1 2.2e-15 PF07645.6.ls 8/15 747 786 .. 1 55 [] 54.9 2.5e-13 PF00008.17.ls 8/16 751 786 .. 1 38 [] 23.2 0.00085 PF07645.6.ls 9/15 788 827 .. 1 55 [] 49.6 9.7e-12 PF07645.6.fs 10/16 788 827 .. 1 55 [] 47.9 8.8e-14 PF00008.17.ls 9/16 792 827 .. 1 38 [] 21.6 0.0027 PF07645.6.ls 10/15 829 869 .. 1 55 [] 46.2 1e-10 PF07645.6.fs 11/16 829 869 .. 1 55 [] 44.4 9.8e-13 PF07645.6.fs 12/16 871 911 .. 1 55 [] 37.7 1.1e-10 PF07645.6.ls 11/15 871 911 .. 1 55 [] 39.5 1.1e-08 PF00008.17.ls 11/16 875 911 .. 1 38 [] 22.6 0.0013 PF00683.8.fs 3/4 984 1027 .. 1 45 [] 74.2 1.2e-22 PF00683.8.ls 3/4 984 1027 .. 1 45 [] 76.1 1e-19 PF00008.17.ls 14/16 1098 1133 .. 1 38 [] 30.2 6.9e-06 PF00008.17.fs 13/15 1098 1133 .. 1 38 [] 28.2 5.3e-07 PF00683.8.fs 4/4 1161 1203 .. 1 45 [] 76.3 2.4e-23 PF00683.8.ls 4/4 1161 1203 .. 1 45 [] 78.3 2.2e-20 PF00008.17.ls 15/16 1252 1287 .. 1 38 [] 29.1 1.4e-05 PF00008.17.fs 14/15 1252 1287 .. 1 38 [] 27.2 1e-06 PF07645.6.fs 16/16 1289 1332 .. 1 55 [] 40.0 2.3e-11 PF07645.6.ls 15/15 1289 1332 .. 1 55 [] 41.7 2.3e-09 PF00008.17.fs 15/15 1293 1332 .. 1 38 [] 28.4 4.8e-07 PF00008.17.ls 16/16 1293 1332 .. 1 38 [] 30.3 6.2e-06 Alignments of top-scoring domains: PF00008.17.fs: domain 1 of 15, from 83 to 110: score 28.7, E = 4e-07 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C+ pC+ngG+C + + +C+Cpp +tGk C hj01412 83 CHL---PCMNGGQCSSRD---KCQCPPN----FTGKLC 110 PF00008.17.ls: domain 1 of 16, from 83 to 110: score 30.4, E = 6e-06 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C+ pC+ngG+C + + +C+Cpp +tGk C hj01412 83 CHL---PCMNGGQCSSRD---KCQCPPN----FTGKLC 110 PF07974.3.ls: domain 1 of 10, from 83 to 110: score 21.2, E = 0.0035 *->C...CngshGtCvspngtstpcgkCvCdsgyedkyqGadC<-* C+ +C + +G+C s + C+C++ ++G+ C hj01412 83 ChlpCMN-GGQCSSRDK-------CQCPPN----FTGKLC 110 PF00683.8.ls: domain 1 of 4, from 246 to 289: score 56.5, E = 8.3e-14 *->grCsnplpgravTKse.CCCsvGrgeAWGtp.CElCPvpg.taefke ++C ++lpg ++K+e+CC +vG+ WG+++C++CP++++++++++ hj01412 246 SQCGKALPG--LSKQEdCCGTVGT--SWGFNkCQKCPKKPsYHGYNQ 288 L<-* + hj01412 289 M 289 PF00683.8.fs: domain 1 of 4, from 246 to 289: score 54.5, E = 1.8e-16 *->grCsnplpgravTKse.CCCsvGrgeAWGtp.CElCPvpg.taefke ++C ++lpg ++K+e+CC +vG+ WG+++C++CP++++++++++ hj01412 246 SQCGKALPG--LSKQEdCCGTVGT--SWGFNkCQKCPKKPsYHGYNQ 288 L<-* + hj01412 289 M 289 PF07645.6.fs: domain 2 of 16, from 306 to 345: score 39.1, E = 4e-11 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC + +C+ n++C+Nt GS++C+ C+ G+ hj01412 306 DINECQLQG--VCP----NGECLNTMGSYRCT----CKIGFG----- 337 nnedgtnC<-* + + C hj01412 338 PDPTFSSC 345 PF07645.6.ls: domain 1 of 15, from 306 to 345: score 40.9, E = 4.1e-09 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC + +C+ n++C+Nt GS++C+ C+ G+ hj01412 306 DINECQLQG--VCP----NGECLNTMGSYRCT----CKIGFG----- 337 nnedgtnC<-* + + C hj01412 338 PDPTFSSC 345 PF00683.8.ls: domain 2 of 4, from 367 to 408: score 65.1, E = 2e-16 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- ++C++pl+++ +TK+ CCCsvG+ AWG++CE+CP+pgta + hj01412 367 RQCMHPLSVH-LTKQLCCCSVGK--AWGPHCEKCPLPGTAKEEPV 408 * hj01412 - - PF00683.8.fs: domain 2 of 4, from 367 to 403: score 67.8, E = 1.2e-20 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgta<-* ++C++pl+++ +TK+ CCCsvG+ AWG++CE+CP+pgta hj01412 367 RQCMHPLSVH-LTKQLCCCSVGK--AWGPHCEKCPLPGTA 403 PF00008.17.ls: domain 3 of 16, from 504 to 540: score 32.7, E = 1.2e-06 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C+ n++ C G C+++p ytC+C +Gy+++ ++++C hj01412 504 CTVNPDICGA-GHCINLPVRYTCICYEGYRFSEQQRKC 540 PF00008.17.fs: domain 3 of 15, from 504 to 540: score 30.7, E = 1e-07 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C+ n++ C G C+++p ytC+C +Gy+++ ++++C hj01412 504 CTVNPDICGA-GHCINLPVRYTCICYEGYRFSEQQRKC 540 PF07645.6.ls: domain 3 of 15, from 542 to 582: score 55.4, E = 1.7e-13 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC + + h C + C+Nt+GSF C Cp+G+ hj01412 542 DIDECTQVQ-HLC----SQGRCENTEGSFLCI----CPAGFM----- 574 nnedgtnC<-* + e+gtnC hj01412 575 ASEEGTNC 582 PF07645.6.fs: domain 4 of 16, from 542 to 582: score 53.7, E = 1.5e-15 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC + + h C + C+Nt+GSF C Cp+G+ hj01412 542 DIDECTQVQ-HLC----SQGRCENTEGSFLCI----CPAGFM----- 574 nnedgtnC<-* + e+gtnC hj01412 575 ASEEGTNC 582 PF00008.17.fs: domain 4 of 15, from 546 to 582: score 25.7, E = 2.7e-06 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ + Cs G+C +t+g++ C+Cp G+ + G +C hj01412 546 CTQVQHLCSQ-GRCENTEGSFLCICPAGFMASEEGTNC 582 PF00008.17.ls: domain 4 of 16, from 546 to 582: score 27.7, E = 3.8e-05 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ + Cs G+C +t+g++ C+Cp G+ + G +C hj01412 546 CTQVQHLCSQ-GRCENTEGSFLCICPAGFMASEEGTNC 582 PF07645.6.fs: domain 5 of 16, from 584 to 623: score 42.3, E = 4.2e-12 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDEC + +C+ ++CvNt+G F+C+ C++GY+ hj01412 584 DVDECLRPD--VCG----EGHCVNTVGAFRCE---YCDSGYR----- 616 nnedgtnC<-* + ++ C hj01412 617 -MTQRGRC 623 PF07645.6.ls: domain 4 of 15, from 584 to 623: score 44.1, E = 4.5e-10 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDEC + +C+ ++CvNt+G F+C+ C++GY+ hj01412 584 DVDECLRPD--VCG----EGHCVNTVGAFRCE---YCDSGYR----- 616 nnedgtnC<-* + ++ C hj01412 617 -MTQRGRC 623 PF07645.6.fs: domain 6 of 16, from 625 to 663: score 39.1, E = 4.1e-11 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC ++ C+ ++ CvN GS++Cv C eG++ hj01412 625 DIDECLNPS--TCP----DEQCVNSPGSYQCV---PCTEGFR----- 657 nnedgtnC<-* + +++C hj01412 658 --GWNGQC 663 PF07645.6.ls: domain 5 of 15, from 625 to 663: score 40.8, E = 4.3e-09 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC ++ C+ ++ CvN GS++Cv C eG++ hj01412 625 DIDECLNPS--TCP----DEQCVNSPGSYQCV---PCTEGFR----- 657 nnedgtnC<-* + +++C hj01412 658 --GWNGQC 663 PF07645.6.fs: domain 7 of 16, from 665 to 704: score 43.5, E = 1.9e-12 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDEC + + ++C an++C N +GS+ C+ C GY+ hj01412 665 DVDECLE-P-NVC----ANGDCSNLEGSYMCS----CHKGYT----- 696 nnedgtnC<-* +d ++C hj01412 697 RTPDHKHC 704 PF07645.6.ls: domain 6 of 15, from 665 to 704: score 45.2, E = 2.1e-10 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse DvDEC + + ++C an++C N +GS+ C+ C GY+ hj01412 665 DVDECLE-P-NVC----ANGDCSNLEGSYMCS----CHKGYT----- 696 nnedgtnC<-* +d ++C hj01412 697 RTPDHKHC 704 PF00008.17.ls: domain 6 of 16, from 669 to 704: score 19.5, E = 0.011 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C + n C n G C +++g+y+C C++Gy + k+C hj01412 669 CLEPN-VCAN-GDCSNLEGSYMCSCHKGYTRTPDHKHC 704 PF07645.6.ls: domain 7 of 15, from 706 to 745: score 42.4, E = 1.4e-09 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC +g C n+ C Nt+GSF+C+ C +GY+ hj01412 706 DIDECQQGN--LC----VNGQCKNTEGSFRCT----CGQGYQ----- 737 nnedgtnC<-* + ++C hj01412 738 LSAAKDQC 745 PF07645.6.fs: domain 8 of 16, from 706 to 745: score 40.7, E = 1.4e-11 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC +g C n+ C Nt+GSF+C+ C +GY+ hj01412 706 DIDECQQGN--LC----VNGQCKNTEGSFRCT----CGQGYQ----- 737 nnedgtnC<-* + ++C hj01412 738 LSAAKDQC 745 PF00008.17.ls: domain 7 of 16, from 710 to 745: score 22.9, E = 0.001 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ n C n G+C +t+g+++C C +Gy+l+ + ++C hj01412 710 CQQGN-LCVN-GQCKNTEGSFRCTCGQGYQLSAAKDQC 745 PF07645.6.fs: domain 9 of 16, from 747 to 786: score 53.1, E = 2.2e-15 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC + h C a + C Nt+GSF+Cv C++GY+ hj01412 747 DIDECQH-R-HLC----AHGQCRNTEGSFQCV----CDQGYR----- 778 nnedgtnC<-* + + g++C hj01412 779 ASGLGDHC 786 PF07645.6.ls: domain 8 of 15, from 747 to 786: score 54.9, E = 2.5e-13 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC + h C a + C Nt+GSF+Cv C++GY+ hj01412 747 DIDECQH-R-HLC----AHGQCRNTEGSFQCV----CDQGYR----- 778 nnedgtnC<-* + + g++C hj01412 779 ASGLGDHC 786 PF00008.17.ls: domain 8 of 16, from 751 to 786: score 23.2, E = 0.00085 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C+ + C + G+C++t+g+++C C++Gy+ ++ G++C hj01412 751 CQHRH-LCAH-GQCRNTEGSFQCVCDQGYRASGLGDHC 786 PF07645.6.ls: domain 9 of 15, from 788 to 827: score 49.6, E = 9.7e-12 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC + + +C + ++C+Nt GS++C+ Cp+G++ hj01412 788 DINECLEDK-SVC----QRGDCINTAGSYDCT----CPDGFQ----- 820 nnedgtnC<-* +d+++C hj01412 821 -LDDNKTC 827 PF07645.6.fs: domain 10 of 16, from 788 to 827: score 47.9, E = 8.8e-14 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC + + +C + ++C+Nt GS++C+ Cp+G++ hj01412 788 DINECLEDK-SVC----QRGDCINTAGSYDCT----CPDGFQ----- 820 nnedgtnC<-* +d+++C hj01412 821 -LDDNKTC 827 PF00008.17.ls: domain 9 of 16, from 792 to 827: score 21.6, E = 0.0027 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C +++ C+ G C++t g+y C Cp G f l + k+C hj01412 792 CLEDKSVCQR-GDCINTAGSYDCTCPDG-FQLDDNKTC 827 PF07645.6.ls: domain 10 of 15, from 829 to 869: score 46.2, E = 1e-10 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC+ ++ C+ ++C+Nt+GSF Cv C +G++ hj01412 829 DINECEHPG--LCG---PQGECLNTEGSFHCV----CQQGFS----- 861 nnedgtnC<-* +dg +C hj01412 862 ISADGRTC 869 PF07645.6.fs: domain 11 of 16, from 829 to 869: score 44.4, E = 9.8e-13 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D++EC+ ++ C+ ++C+Nt+GSF Cv C +G++ hj01412 829 DINECEHPG--LCG---PQGECLNTEGSFHCV----CQQGFS----- 861 nnedgtnC<-* +dg +C hj01412 862 ISADGRTC 869 PF07645.6.fs: domain 12 of 16, from 871 to 911: score 37.7, E = 1.1e-10 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC + t +C d + C Nt GSF+C+ C +G++ hj01412 871 DIDECVNNT--VC---DSHGFCDNTAGSFRCL----CYQGFQ----- 903 nnedgtnC<-* + dg C hj01412 904 APQDGQGC 911 PF07645.6.ls: domain 11 of 15, from 871 to 911: score 39.5, E = 1.1e-08 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC + t +C d + C Nt GSF+C+ C +G++ hj01412 871 DIDECVNNT--VC---DSHGFCDNTAGSFRCL----CYQGFQ----- 903 nnedgtnC<-* + dg C hj01412 904 APQDGQGC 911 PF00008.17.ls: domain 11 of 16, from 875 to 911: score 22.6, E = 0.0013 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C n+ C+ +G+C +t g+++C C +G++ +G C hj01412 875 CVNNT-VCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGC 911 PF00683.8.fs: domain 3 of 4, from 984 to 1027: score 74.2, E = 1.2e-22 *->grCsnplpgravTKseCCCsvGrgeAWGtpCE..lCPvpgtaefkeL + C+n l+ + vTK+eCCC++G+ +WG++CE +CPv gtaef e+ hj01412 984 SLCDNVLAPN-VTKQECCCTSGA--GWGDNCEifPCPVLGTAEFTEM 1027 <-* hj01412 - - PF00683.8.ls: domain 3 of 4, from 984 to 1027: score 76.1, E = 1e-19 *->grCsnplpgravTKseCCCsvGrgeAWGtpCE..lCPvpgtaefkeL + C+n l+ + vTK+eCCC++G+ +WG++CE +CPv gtaef e+ hj01412 984 SLCDNVLAPN-VTKQECCCTSGA--GWGDNCEifPCPVLGTAEFTEM 1027 <-* hj01412 - - PF00008.17.ls: domain 14 of 16, from 1098 to 1133: score 30.2, E = 6.9e-06 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ C G+Cv+t+g+y C+C+++++l+ + krC hj01412 1098 CQDPS-SCID-GQCVNTEGSYNCFCTHPMVLDASEKRC 1133 PF00008.17.fs: domain 13 of 15, from 1098 to 1133: score 28.2, E = 5.3e-07 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ C G+Cv+t+g+y C+C+++++l+ + krC hj01412 1098 CQDPS-SCID-GQCVNTEGSYNCFCTHPMVLDASEKRC 1133 PF00683.8.fs: domain 4 of 4, from 1161 to 1203: score 76.3, E = 2.4e-23 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- ++Cs+pl+g+++T++eCCC +G+ AWG++C lCP+++++++++L hj01412 1161 YVCSRPLVGKQTTYTECCCLYGE--AWGMQCALCPLKDSDDYAQL 1203 * hj01412 - - PF00683.8.ls: domain 4 of 4, from 1161 to 1203: score 78.3, E = 2.2e-20 *->grCsnplpgravTKseCCCsvGrgeAWGtpCElCPvpgtaefkeL<- ++Cs+pl+g+++T++eCCC +G+ AWG++C lCP+++++++++L hj01412 1161 YVCSRPLVGKQTTYTECCCLYGE--AWGMQCALCPLKDSDDYAQL 1203 * hj01412 - - PF00008.17.ls: domain 15 of 16, from 1252 to 1287: score 29.1, E = 1.4e-05 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C n +C n G+Cv++++gytC+C Gy+l+ + +C hj01412 1252 CGILN-GCEN-GRCVRVQEGYTCDCFDGYHLDTAKMTC 1287 PF00008.17.fs: domain 14 of 15, from 1252 to 1287: score 27.2, E = 1e-06 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C n +C n G+Cv++++gytC+C Gy+l+ + +C hj01412 1252 CGILN-GCEN-GRCVRVQEGYTCDCFDGYHLDTAKMTC 1287 PF07645.6.fs: domain 16 of 16, from 1289 to 1332: score 40.0, E = 2.3e-11 *->DvDECadgtlh...nCdDpdantvCvNtiGSFeCvarkdCpeGYeVp Dv+EC++ ++ + C +n++C+Nt+GS++C+ C +GY hj01412 1289 DVNECDELN-NrmsLC----KNAKCINTDGSYKCL----CLPGYV-- 1324 vsennedgtnC<-* + + ++ C hj01412 1325 ---PSDKPNYC 1332 PF07645.6.ls: domain 15 of 15, from 1289 to 1332: score 41.7, E = 2.3e-09 *->DvDECadgtlh...nCdDpdantvCvNtiGSFeCvarkdCpeGYeVp Dv+EC++ ++ + C +n++C+Nt+GS++C+ C +GY hj01412 1289 DVNECDELN-NrmsLC----KNAKCINTDGSYKCL----CLPGYV-- 1324 vsennedgtnC<-* + + ++ C hj01412 1325 ---PSDKPNYC 1332 PF00008.17.fs: domain 15 of 15, from 1293 to 1332: score 28.4, E = 4.8e-07 *->Cspnn...gpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ n++ C+n ++C++t+g+y+C C pGy+ + + +C hj01412 1293 CDELNnrmSLCKN-AKCINTDGSYKCLCLPGYVPSDKPNYC 1332 PF00008.17.ls: domain 16 of 16, from 1293 to 1332: score 30.3, E = 6.2e-06 *->Cspnn...gpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ n++ C+n ++C++t+g+y+C C pGy+ + + +C hj01412 1293 CDELNnrmSLCKN-AKCINTDGSYKCLCLPGYVPSDKPNYC 1332 //