hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080812/iprscan-20080812-15043289/chunk_1/iprscan-20080812-15043289.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hj02221 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00993.11.ls Class II histocompatibility antigen, alp 163.2 6e-46 1 PF00993.11.fs Class II histocompatibility antigen, alp 161.2 2.4e-45 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00993.11.fs 1/1 39 119 .. 1 84 [] 161.2 2.4e-45 PF00993.11.ls 1/1 39 119 .. 1 84 [] 163.2 6e-46 Alignments of top-scoring domains: PF00993.11.fs: domain 1 of 1, from 39 to 119: score 161.2, E = 2.4e-45 *->dHvgiyGinfyQssgpsGeythefDGDElFYvDLekKetVwrLPeFa dHv++y ++f+Q+++p Ge+++efD+DE+FYvDL+kKetVw+L eF+ hj02221 39 DHVSTY-AAFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFG 84 dfasfdgfpQgalaniaicKhNLdvlikrsNsTPatn<-* + +sf+ +Qg+laniai+ +NL++li+rsN+T+a n hj02221 85 RAFSFE--AQGGLANIAILNNNLNTLIQRSNHTQAAN 119 PF00993.11.ls: domain 1 of 1, from 39 to 119: score 163.2, E = 6e-46 *->dHvgiyGinfyQssgpsGeythefDGDElFYvDLekKetVwrLPeFa dHv++y ++f+Q+++p Ge+++efD+DE+FYvDL+kKetVw+L eF+ hj02221 39 DHVSTY-AAFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFG 84 dfasfdgfpQgalaniaicKhNLdvlikrsNsTPatn<-* + +sf+ +Qg+laniai+ +NL++li+rsN+T+a n hj02221 85 RAFSFE--AQGGLANIAILNNNLNTLIQRSNHTQAAN 119 //