hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080812/iprscan-20080812-15403175/chunk_1/iprscan-20080812-15403175.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: hj03059
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00037                                                  82.0      7e-20   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00037    1/1      51    84 ..     1    34 []    82.0    7e-20

Alignments of top-scoring domains:
SM00037: domain 1 of 1, from 51 to 84: score 82.0, E = 7e-20
                   *->svwgDeqsdFvCntqqPGCenvCYDkafPishvR<-*
                      s+wgDeqs+F+CntqqPGCenvCYDk fPishvR   
     hj03059    51    SAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVR    84   

//