hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/TIGRFAMs_HMM.LIB.bin Sequence file: /db/iprscan/tmp/20090416/iprscan-20090416-16505766/chunk_1/iprscan-20090416-16505766.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hj03737 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TIGR00756 PPR: pentatricopeptide repeat domain 136.7 2.1e-38 11 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TIGR00756 2/11 165 199 .. 1 35 [] 7.3 0.68 TIGR00756 3/11 200 234 .. 1 35 [] 21.3 0.0012 TIGR00756 4/11 235 269 .. 1 35 [] 25.4 6.5e-05 TIGR00756 5/11 270 304 .. 1 35 [] 15.7 0.055 TIGR00756 8/11 751 785 .. 1 35 [] 17.2 0.02 TIGR00756 9/11 958 992 .. 1 35 [] 14.4 0.084 TIGR00756 11/11 1321 1355 .. 1 35 [] 24.5 0.00013 Alignments of top-scoring domains: TIGR00756: domain 2 of 11, from 165 to 199: score 7.3, E = 0.68 *->vtYntlidglckagrveeAlelfdeMkerGikPdv<-* Yn+l++++ ++ +++ +M+e++i+P+ hj03737 165 SHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNR 199 TIGR00756: domain 3 of 11, from 200 to 234: score 21.3, E = 0.0012 *->vtYntlidglckagrveeAlelfdeMkerGikPdv<-* vtY li ++c g++e A +++ Mk +++ +++ hj03737 200 VTYQRLIASYCNVGDIEGASKILGFMKTKDLPVTE 234 TIGR00756: domain 4 of 11, from 235 to 269: score 25.4, E = 6.5e-05 *->vtYntlidglckagrveeAlelfdeMkerGikPdv<-* ++++l+ g+++ag++e A+ ++ M+++Gi+P hj03737 235 AVFSALVTGHARAGDMENAENILTVMRDAGIEPGP 269 TIGR00756: domain 5 of 11, from 270 to 304: score 15.7, E = 0.055 *->vtYntlidglckagrveeAlelfdeMkerGikPdv<-* tY +l++++++ g+++++++ +++ +++ + + hj03737 270 DTYLALLNAYAEKGDIDHVKQTLEKVEKSELHLMD 304 TIGR00756: domain 8 of 11, from 751 to 785: score 17.2, E = 0.02 *->vtYntlidglckagrveeAlelfdeMkerGikPdv<-* Y l+++l+k+g++++A+ +++eMke+++ + hj03737 751 GKYVGLVRVLAKHGKLQDAINILKEMKEKDVLIKD 785 TIGR00756: domain 9 of 11, from 958 to 992: score 14.4, E = 0.084 *->vtYntlidglckagrveeAlelfdeMkerGikPdv<-* +Y l++ + +g++++A +++++++e+++ P + hj03737 958 QMYYNLLKLYKINGDWQRADAVWNKIQEENVIPRE 992 TIGR00756: domain 11 of 11, from 1321 to 1355: score 24.5, E = 0.00013 *->vtYntlidglckagrveeAlelfdeMkerGikPdv<-* ++Yn+l+++++ +++v A++l++ + +++ k+d hj03737 1321 EAYNSLMKSYVSEKDVTSAKALYEHLTAKNTKLDD 1355 //