hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080812/iprscan-20080812-20443160/chunk_1/iprscan-20080812-20443160.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hk01154 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00385 116.2 3.7e-30 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00385 1/2 230 314 .. 1 90 [] 63.7 2.4e-14 SM00385 2/2 331 409 .. 1 90 [] 52.5 5.5e-11 Alignments of top-scoring domains: SM00385: domain 1 of 2, from 230 to 314: score 63.7, E = 2.4e-14 *->dfLrrvakalnldpetlylAvnlldrfLseykvlkgyspsliAaaal d+L++va ++++ +l+l+v +dr+L+ ++++++y+++l+++a++ hk01154 230 DWLVEVATMKDFTSLCLHLTVECVDRYLR-RRLVPRYRLQLLGIACM 275 ylAsKteeippwtktlfhytgylppelayteeeilemekllle<-* + ++ ++ t+ ++ ++++ +y+ e++++m+ ++++ hk01154 276 VICTRFISKEILTIREAVWLTDN----TYKYEDLVRMMGEIVS 314 SM00385: domain 2 of 2, from 331 to 409: score 52.5, E = 5.5e-11 *->dfLrrvakalnldpetlylAvnlldrfLseykvlkgyspsliAaaal + L v +l+ t++l+ +l++++L+ +++l+ y p +Aaaal hk01154 331 VLLTLVPVELR----TQHLCSFLCELSLL-HTSLSAYAPARLAAAAL 372 ylAsKteeip.pwtktlfhytgylppelayteeeilemekllle<-* +lA+ t++ ++pwt +l+ tg + e+++++++ l++ hk01154 373 LLARLTHGQTqPWTTQLWDLTGF-------SYEDLIPCVLSLHK 409 //