hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080812/iprscan-20080812-21012017/chunk_1/iprscan-20080812-21012017.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: hk01625 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00501 147.7 1.2e-39 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00501 1/1 257 349 .. 1 95 [] 147.7 1.2e-39 Alignments of top-scoring domains: SM00501: domain 1 of 1, from 257 to 349: score 147.7, E = 1.2e-39 *->rerelFldrLykFmeergtpilkiPviggkpklDLyrLyrlVkerGG +er++Fld L Fm++rgtpi++iP++ +++ lDLy+Ly+lV+e+GG hk01625 257 PERKEFLDDLFVFMQKRGTPINRIPIMAKQI-LDLYMLYKLVTEKGG 302 ydaVtkdkkWkeiaeelgipdtistsasssLrkhYlryLlpfEeflrg<- +++++ +k W+ei+ l+ p++ +tsa+++Lr++Y++yL+++E++ + hk01625 303 LVEIINKKIWREITKGLNLPTS-ITSAAFTLRTQYMKYLYAYECEKKA 349 * hk01625 - - //