hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080812/iprscan-20080812-22531118/chunk_1/iprscan-20080812-22531118.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: hk04187
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00471                                                  32.9    4.4e-05   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00471    1/1     393   568 ..     1    59 []    32.9  4.4e-05

Alignments of top-scoring domains:
SM00471: domain 1 of 1, from 393 to 568: score 32.9, E = 4.4e-05
                   *->hgetrleHslrVaqlarela..............ellllAALLHDiG
                       ++++  H+ +Vaq ++ l++++  +   ++ + +++++AA  HD++
     hk04187   393    VAYHNSLHAADVAQSTHVLLstpaldavftdleiLAAIFAAAIHDVD 439  

                   kp................................................
                   +p+ ++    + +++     ++++  ++++   + +   +++ +   +  
     hk04187   440 HPgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnlt 489  

                   ..................................................
                   ++ +   ++   +     + +++ +   + +   + ++  +++    ++ 
     hk04187   490 kkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldny 539  

                   ....slearivklADrldalrrdr.yrrv<-*
                    ++  ++  +v++AD + ++++++ yr++   
     hk04187   540 tdriQVLRNMVHCADLSNPTKSLElYRQW    568  

//