hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-03364827/chunk_1/iprscan-20080813-03364827.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pf00008 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00060 493.3 1.1e-143 15 SM00186 413.7 1.1e-119 1 SM00181 211.2 9.3e-59 14 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00181 1/14 221 249 .. 1 32 [] 17.9 1.5 SM00181 2/14 252 280 .. 1 32 [] 9.9 34 SM00181 3/14 283 312 .. 1 32 [] 17.3 2.1 SM00181 4/14 315 343 .. 1 32 [] 16.3 4.4 SM00181 5/14 346 374 .. 1 32 [] 9.1 40 SM00181 6/14 377 405 .. 1 32 [] 8.5 45 SM00181 7/14 408 436 .. 1 32 [] 18.9 0.73 SM00181 8/14 439 467 .. 1 32 [] 16.0 5.3 SM00181 9/14 470 498 .. 1 32 [] 12.1 22 SM00181 10/14 501 529 .. 1 32 [] 18.9 0.73 SM00181 11/14 532 560 .. 1 32 [] 17.2 2.3 SM00181 12/14 563 591 .. 1 32 [] 17.2 2.4 SM00181 13/14 594 622 .. 1 32 [] 13.7 16 SM00181 14/14 625 653 .. 1 32 [] 18.3 1.1 SM00060 1/15 655 735 .. 1 69 [] 42.7 4.9e-08 SM00060 2/15 744 826 .. 1 69 [] 37.3 2e-06 SM00060 3/15 835 914 .. 1 69 [] 45.1 9e-09 SM00060 4/15 925 1006 .. 1 69 [] 46.0 4.8e-09 SM00060 5/15 1017 1094 .. 1 69 [] 45.2 8.9e-09 SM00060 6/15 1106 1184 .. 1 69 [] 24.8 0.012 SM00060 7/15 1197 1277 .. 1 69 [] 22.7 0.053 SM00060 8/15 1288 1366 .. 1 69 [] 26.5 0.0036 SM00060 9/15 1379 1457 .. 1 69 [] 21.0 0.16 SM00060 10/15 1470 1550 .. 1 69 [] 12.0 8.8 SM00060 11/15 1561 1640 .. 1 69 [] 14.8 4.1 SM00060 12/15 1652 1731 .. 1 69 [] 26.1 0.005 SM00060 13/15 1742 1820 .. 1 69 [] 41.9 8.7e-08 SM00060 14/15 1831 1908 .. 1 69 [] 40.9 1.7e-07 SM00060 15/15 1919 1996 .. 1 69 [] 46.3 4.1e-09 SM00186 1/1 2011 2221 .. 1 262 [] 413.7 1.1e-119 Alignments of top-scoring domains: SM00181: domain 1 of 14, from 221 to 249: score 17.9, E = 1.5 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* eC + C+ G+Ci +C C +G+tg+ C pf00008 221 ECPgNCHLR-----GRCIDGQCiCD-DGFTGeDCS 249 SM00181: domain 2 of 14, from 252 to 280: score 9.9, E = 34 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C ++C G+C+ C C +Gy g C pf00008 252 ACPsDCNDQ-----GKCVNGVCiCF-EGYAGaDCS 280 SM00181: domain 3 of 14, from 283 to 312: score 17.3, E = 2.1 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C pCs+ +GtC+ C C+ +G+ g+ C pf00008 283 ICPvPCSEE----HGTCVDGLCvCH-DGFAGdDCN 312 SM00181: domain 4 of 14, from 315 to 343: score 16.3, E = 4.4 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C++ C n G+C+ +C C +G+tg+ C pf00008 315 LCLnNCYNR-----GRCVENECvCD-EGFTGeDCS 343 SM00181: domain 5 of 14, from 346 to 374: score 9.1, E = 40 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C ++C G+Ci tC C +G+tg+ C pf00008 346 ICPnDCFDR-----GRCINGTCyCE-EGFTGeDCG 374 SM00181: domain 6 of 14, from 377 to 405: score 8.5, E = 45 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C + C+ G+C +C C +G+ g C pf00008 377 TCPhACHTQ-----GRCEEGQCvCD-EGFAGvDCS 405 SM00181: domain 7 of 14, from 408 to 436: score 18.9, E = 0.73 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C +C+n G+C+ +C+C +G+tg C pf00008 408 RCPaDCHNR-----GRCVDGRCeCD-DGFTGaDCG 436 SM00181: domain 8 of 14, from 439 to 467: score 16.0, E = 5.3 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C ++Cs + G+C+ +C C +Gytg+ C pf00008 439 KCPnGCSGH-----GRCVNGQCvCD-EGYTGeDCS 467 SM00181: domain 9 of 14, from 470 to 498: score 12.1, E = 22 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C ++C+ G+C+ +C C +G++g C pf00008 470 RCPnDCHSR-----GRCVEGKCvCE-QGFKGyDCS 498 SM00181: domain 10 of 14, from 501 to 529: score 18.9, E = 0.73 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C ++C+++ G+C+ C C +Gytg+ C pf00008 501 SCPnDCHQH-----GRCVNGMCvCD-DGYTGeDCR 529 SM00181: domain 11 of 14, from 532 to 560: score 17.2, E = 2.3 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C ++Csn G C+ +C C +G+tg+ C pf00008 532 QCPrDCSNR-----GLCVDGQCvCE-DGFTGpDCA 560 SM00181: domain 12 of 14, from 563 to 591: score 17.2, E = 2.4 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C ++C+ G+C+ +C C+ +G++g+ C+ pf00008 563 SCPnDCHGR-----GRCVNGQCvCH-EGFMGkDCK 591 SM00181: domain 13 of 14, from 594 to 622: score 13.7, E = 16 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C ++C+ G+C+ +C C+ +G+tg C pf00008 594 RCPsDCHGQ-----GRCVDGQCiCH-EGFTGlDCG 622 SM00181: domain 14 of 14, from 625 to 653: score 18.3, E = 1.1 *->eCa.pCsnGgtEqnGtCisytC.CpgpGytg.rCe<-* C ++C n G+C+s +C C +Gy+g+ C pf00008 625 SCPsDCNNL-----GQCVSGRCiCN-EGYSGeDCS 653 SM00060: domain 1 of 15, from 655 to 735: score 42.7, E = 4.9e-08 *->PgpPsnptelrvtdvtststsdltsvtlsWepP..ivgYr....... +pP++ l+vt+vt+ +v+l W+ +++Y ++ +++ pf00008 655 VSPPKD---LVVTEVTEE------TVNLAWDNEmrVTEYLvvytpth 692 ................ytltgLkPgaepwteYefrVrAvngndaGeg<-* +++ + + ++++++++ +++ L+Pg eY +rV A+ +n++ + pf00008 693 egglemqfrvpgdqtsTIIRELEPG----VEYFIRVFAILENKKSIP 735 SM00060: domain 2 of 15, from 744 to 826: score 37.3, E = 2e-06 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. ++P++ l+++++ +t sv+++W+p + + ++ +r+ pf00008 744 LPAPEG---LKFKSIKET------SVEVEWDPLdiafetwEIIFRnm 781 ..................ytltgLkPgaepwteYefrVrAvngndaGeg< +++++++ +++ ++++++y+ tgL Pg +eYe+++ v n +G+g pf00008 782 nkedegeitkslrrpetsYRQTGLAPG----QEYEISLHIVKNNTRGPG 826 -* pf00008 - - SM00060: domain 3 of 15, from 835 to 914: score 45.1, E = 9e-09 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. ++Ps ++v+dvt+t ++ ++W +P + ++ +++Y + pf00008 835 LDAPSQ---IEVKDVTDT------TALITWFKPlaeidgiELTYGik 872 .................ytltgLkPgaepwteYefrVrAvngndaGeg<- ++++++++ + ++++++y + +LkP+ teYe++++ + g + ++ pf00008 873 dvpgdrttidltedenqYSIGNLKPD----TEYEVSLISRRG--DMSS 914 * pf00008 - - SM00060: domain 4 of 15, from 925 to 1006: score 46.0, E = 4.8e-09 *->PgpPsnptelrvtdvtststsdltsvtlsWepP...ivgYr...... ++P+n lr ++ t++ s+tl+W + i +Yr + + pf00008 925 LDAPRN---LRRVSQTDN------SITLEWRNGkaaIDSYRikyapi 962 ...................ytltgLkPgaepwteYefrVrAvngndaGeg ++++ +++++++++ +++ tltgL+Pg teY + V+Av + + e+ pf00008 963 sggdhaevdvpksqqattkTTLTGLRPG----TEYGIGVSAVKE--DKES 1006 <-* pf00008 - - SM00060: domain 5 of 15, from 1017 to 1094: score 45.2, E = 8.9e-09 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. + P++ l+v+++ +t s+tl W+ P + + ++++Y+ + pf00008 1017 LDTPKD---LQVSETAET------SLTLLWKTPlakfdryRLNYSlp 1054 ...............ytltgLkPgaepwteYefrVrAvngndaGeg<-* ++++++++ ++++++y+l+gL+Pg +eY++ ++A+ g + + pf00008 1055 tgqwvgvqlprnttsYVLRGLEPG----QEYNVLLTAEKG--RHKS 1094 SM00060: domain 6 of 15, from 1106 to 1184: score 24.8, E = 0.012 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. + +n l+vt+v+ + ++l W++ + +++ i++ ++ pf00008 1106 APELEN---LTVTEVGWD------GLRLNWTAAdqayehfIIQVQea 1143 .................ytltgLkPgaepwteYefrVrAvngndaGeg<- ++++ ++ +++++ + + ++gLk+ t Y+++++ v +G+ pf00008 1144 nkveaarnltvpgslraVDIPGLKAA----TPYTVSIYGVI---QGYR 1184 * pf00008 - - SM00060: domain 7 of 15, from 1197 to 1277: score 22.7, E = 0.053 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. + + ++v +v+ + + l W++P++ +++ ++ ++ pf00008 1197 TPNLGE---VVVAEVGWD------ALKLNWTAPegayeyfFIQVQea 1234 .................ytltgLkPgaepwteYefrVrAvngndaGeg<- ++++ ++ +++++ ++ l+gLk+ t Y++++r v+ d pf00008 1235 dtveaaqnltvpgglrsTDLPGLKAA----THYTITIRGVTQ-DFSTT 1277 * pf00008 - - SM00060: domain 8 of 15, from 1288 to 1366: score 26.5, E = 0.0036 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. + +n l+vt+v+ + ++l W+ P++ ++ +++ ++ pf00008 1288 VPDMGN---LTVTEVSWD------ALRLNWTTPdgtydqfTIQVQea 1325 .................ytltgLkPgaepwteYefrVrAvngndaGeg<- +++++ + +++++ ++ ++gL++g t Y++++ + +G + pf00008 1326 dqveeahnltvpgslrsMEIPGLRAG----TPYTVTLHGEV---RGHS 1366 * pf00008 - - SM00060: domain 9 of 15, from 1379 to 1457: score 21.0, E = 0.16 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. + ++ l v++v+ + ++l W++ ++ +++ +++ +++ pf00008 1379 LPQLGD---LAVSEVGWD------GLRLNWTAAdnayehfVIQVQev 1416 .................ytltgLkPgaepwteYefrVrAvngndaGeg<- ++++ ++ + +++ + + ++gL++ t Y+++++ v +G+ pf00008 1417 nkveaaqnltlpgslraVDIPGLEAA----TPYRVSIYGVI---RGYR 1457 * pf00008 - - SM00060: domain 10 of 15, from 1470 to 1550: score 12.0, E = 8.8 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. + +n l v+d+t+ s++lsW + ++ + +++ +++ pf00008 1470 EPEIGN---LNVSDITPE------SFNLSWMATdgifetfTIEIIds 1507 .................ytltgLkPgaepwteYefrVrAvngndaGeg<- ++ ++++ + ++ ++++ ++gL P t + ++ + pf00008 1508 nrlletveynisgaertAHISGLPPS----TDFIVYLSGLAP-SIRTK 1550 * pf00008 - - SM00060: domain 11 of 15, from 1561 to 1640: score 14.8, E = 4.1 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. + +n l+++d+++ +t+sW + ++ ++ v+ +++ pf00008 1561 LPLLEN---LTISDINPY------GFTVSWMASenafdsfLVTVVds 1598 .................ytltgLkPgaepwteYefrVrAvngndaGeg<- ++ ++++ + ++++++ l+gL g Ye+ V+ ++ + + pf00008 1599 gklldpqeftlsgtqrkLELRGLITG----IGYEVMVSGFTQ--GHQT 1640 * pf00008 - - SM00060: domain 12 of 15, from 1652 to 1731: score 26.1, E = 0.005 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. + + n l v+d t++ ++lsW++ ++ ++ ++ r++ pf00008 1652 EPEVDN---LLVSDATPD------GFRLSWTADegvfdnfVLKIRdt 1689 .................ytltgLkPgaepwteYefrVrAvngndaGeg<- ++++++ + + ++++ +tgL++ teYe+ ++ +++ + ++ pf00008 1690 kkqsepleitllapertRDITGLREA----TEYEIELYGISK--GRRS 1731 * pf00008 - - SM00060: domain 13 of 15, from 1742 to 1820: score 41.9, E = 8.7e-08 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. g+P+ + ++d+t++ s+t+sW +P ++ +++Y++ pf00008 1742 MGSPKE---VIFSDITEN------SATVSWRAPtaqvesfRITYVpi 1779 ................ytltgLkPgaepwteYefrVrAvngndaGeg<-* ++++++ +++++++++ +l L Pg eY ++++A g e+ pf00008 1780 tggtpsmvtvdgtktqTRLVKLIPG----VEYLVSIIAMKG--FEES 1820 SM00060: domain 14 of 15, from 1831 to 1908: score 40.9, E = 1.7e-07 *->PgpPsnptelrvtdvtststsdltsvtlsWepP.......ivgYr.. + Ps+ l+ ++t++ + +W+p ++++++Y+++ pf00008 1831 LDGPSG---LVTANITDS------EALARWQPAiatvdsyVISYTge 1868 ...............ytltgLkPgaepwteYefrVrAvngndaGeg<-* ++++ ++++++++++y lt+L+P teY+ r+ A+ g + pf00008 1869 kvpeitrtvsgntveYALTDLEPA----TEYTLRIFAEKG--PQKS 1908 SM00060: domain 15 of 15, from 1919 to 1996: score 46.3, E = 4.1e-09 *->PgpPsnptelrvtdvtststsdltsvtlsWepP...ivgYr...... ++P++ l++t+v s ++ l+W pP +++gY + +++ pf00008 1919 LDSPRD---LTATEVQSE------TALLTWRPPrasVTGYLlvyesv 1956 ...............ytltgLkPgaepwteYefrVrAvngndaGeg<-* +++++++ +++++++y l +L+P t Y+ +++A ng ++ pf00008 1957 dgtvkevivgpdttsYSLADLSPS----THYTAKIQALNG--PLRS 1996 SM00186: domain 1 of 1, from 2011 to 2221: score 413.7, E = 1.1e-119 *->klprDCsdvlqknnGgktSGlYtIypdgsrsrplkVyCDMeTdGGGW ++p+DCs+ + nG +tSGlYtIy++g+ + l+V+CDM++dGGGW pf00008 2011 PFPKDCSQAML--NGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGW 2055 TViQrRmDGsvdFyRgWkdYkeGFGnldgkgtGKiCviGEFWLGNeniHl +V+ rR +G ++Fy +Wk+Y++GFG+ + EFWLG++n+++ pf00008 2056 IVFLRRKNGRENFYQNWKAYAAGFGDRR----------EEFWLGLDNLNK 2095 LTsqgktpyeLRvDLeDwegntayAkYdrFkvadwvefdkeadgYrLhig +T+qg+ yeLRvDL+ + g+ta+A Yd+F+v+d + Y+L ++ pf00008 2096 ITAQGQ--YELRVDLR-DHGETAFAVYDKFSVGD------AKTRYKLKVE 2136 gYsGtAGDaLvfGadqeksltyHngmqFSTyDrDNDkyetnnPtkCAeey gYsGtAGD s++yHng+ FST+D+D D+++tn CA++y pf00008 2137 GYSGTAGD----------SMAYHNGRSFSTFDKDTDSAITN----CALSY 2172 gGGWWYnsChaaNLNGrYYpgGeYdktkvdygydnGInWatwkGsatGdv +G++WY++Ch++NL+GrY+ d+++++G+nW++wkG+ pf00008 2173 KGAFWYRNCHRVNLMGRYG----------DNNHSQGVNWFHWKGH----- 2207 ywySlkfteMKiRPl<-* + S++f+eMK+RP pf00008 2208 -EHSIQFAEMKLRPS 2221 //