hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-05155671/chunk_1/iprscan-20080813-05155671.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pf02435 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00291 66.8 2.7e-15 1 SM00150 61.4 1.1e-13 2 SM00456 41.3 1.3e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00150 1/2 109 231 .. 1 104 [] 26.3 0.0042 SM00150 2/2 238 340 .. 1 104 [] 35.1 9.4e-06 SM00456 1/1 357 389 .. 1 34 [] 41.3 1.3e-07 SM00291 1/1 608 653 .. 1 46 [] 66.8 2.7e-15 Alignments of top-scoring domains: SM00150: domain 1 of 2, from 109 to 231: score 26.3, E = 0.0042 *->qqFlrdadeleaWleeke.qllssedlgeskDlesveallkkHqale +++ ++e+++Wl+ k ++l ++ +l +D++ v++ + H a++ pf02435 109 GKLQLPLQEIIDWLSQKDeELSAQLPLQ--GDVALVQQEKETHAAFM 153 aelaaheervdalnelgeqLiee.......sghpdaeeIeerl....... +e++ +++ + ++ e +++++++++ ++ ++ h ++++ +++ ++ ++ pf02435 154 EEVKSRGPYIYSVLESAQAFLSQhpfeeleEPHSESKDTSPKQriqnlsr 203 ......eelnerWeeLlelaeeRrqkLe<-* ++ + e We+L +++ +++++ e pf02435 204 fvwkqaTVASELWEKLTARCVDQHRHIE 231 SM00150: domain 2 of 2, from 238 to 340: score 35.1, E = 9.4e-06 *->qqFlrdadeleaWleeke.qllssedlgeskDlesveallkkHqale + + +++el l+ +e++ ++ e++g + ++s+ + ++ + ++ pf02435 238 LEIQGAMEELSTTLSQAEgVRATWEPIG-DLFIDSLPEHIQAIKLFK 283 aelaaheervdalnelgeqLieesghpdaeeIeerleelnerWeeLlela +e + ++ v+ +n+l+ qL + + + e + le++n rW++L++ + pf02435 284 EEFSPMKDGVKLVNDLAHQLAIS-DVHLSMENSQALEQINVRWKQLQASV 332 eeRrqkLe<-* eR ++L+ pf02435 333 SERLKQLQ 340 SM00456: domain 1 of 1, from 357 to 389: score 41.3, E = 1.3e-07 *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-* +++ +We++++p+ + pYY+Nh+ ++t+W++P + pf02435 357 SVQVPWERAISPN-KVPYYINHQAQTTCWDHPKM 389 SM00291: domain 1 of 1, from 608 to 653: score 66.8, E = 2.7e-15 *->vhhsvsCdgCgkepivgvRYkClvCpDYDLCesCfakGghhgeHam< v+h+ +C++C+++pi g+RY++l+ ++ D+C++Cf +G++++ +++ pf02435 608 VKHQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKL 653 -* pf02435 - - //