hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-05231725/chunk_1/iprscan-20080813-05231725.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pf02494 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00059 100.1 2.6e-25 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00059 1/1 1819 1865 .. 1 49 [] 100.1 2.6e-25 Alignments of top-scoring domains: SM00059: domain 1 of 1, from 1819 to 1865: score 100.1, E = 2.6e-25 *->gnsdGapCvFPFiYrGksYhdCTseGrndgmlWCsTTsnYDrDgkWg ++ dG pCvFPFi++GksY++C+ e r+ lWCsTT++YDrD+ Wg pf02494 1819 ETDDGVPCVFPFIFNGKSYEECIIESRAK--LWCSTTADYDRDHEWG 1863 fC<-* fC pf02494 1864 FC 1865 //