hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20090525/iprscan-20090525-17434465/chunk_1/iprscan-20090525-17434465.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: pf03857
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model      Description                                  Score    E-value  N 
--------   -----------                                  -----    ------- ---
SM00431                                                 261.8    5.6e-74   1
SM00355                                                 160.7    1.4e-43   6

Parsed for domains:
Model      Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------   ------- ----- -----    ----- -----      -----  -------
SM00431      1/1      23   135 ..     1   113 []   261.8  5.6e-74
SM00355      1/6     687   709 ..     1    23 []    29.2  0.00056
SM00355      2/6     715   737 ..     1    23 []    28.2   0.0012
SM00355      3/6     743   765 ..     1    23 []    28.9  0.00071
SM00355      4/6     771   793 ..     1    23 []    29.9  0.00036
SM00355      5/6     799   821 ..     1    23 []    28.1   0.0012
SM00355      6/6     827   849 ..     1    23 []    16.5      3.8

Alignments of top-scoring domains:
SM00431: domain 1 of 1, from 23 to 135: score 261.8, E = 5.6e-74
                   *->pEifRqrFRqFrYqEtsGPREALSRLRELCrqWLRPElhTKEQILEL
                      +E+fRqrFR+F YqE++GPREA+S+L+ELC++WLRPE++TKEQI EL
     pf03857    23    SETFRQRFRRFHYQEVAGPREAFSQLWELCCRWLRPEVRTKEQIVEL 69   

                   LVLEQFLTILPgELQaWVrehhPeSGEEAVtLlEdLereLdepgqqVsah
                   LVLEQFLT+LPgE+Q WV+e++Pe+GEEAVtL+EdLere+ +p+  V++ 
     pf03857    70 LVLEQFLTVLPGEIQNWVQEQCPENGEEAVTLVEDLEREPGRPRSSVTVS 119  

                   vhgqevLleemvplga<-*
                   v+gqev le+m p+     
     pf03857   120 VKGQEVRLEKMTPPKS    135  

SM00355: domain 1 of 6, from 687 to 709: score 29.2, E = 0.00056
                   *->ykCpigCgksfssk.aLkrHmrvH<-*
                      ykC   Cgksfs+   L+rH r+H   
     pf03857   687    YKCAD-CGKSFSRSaRLIRHRRIH    709  

SM00355: domain 2 of 6, from 715 to 737: score 28.2, E = 0.0012
                   *->ykCpigCgksfssk.aLkrHmrvH<-*
                      ykC   Cgksf++ ++++ H r+H   
     pf03857   715    YKCLD-CGKSFRDSsNFITHRRIH    737  

SM00355: domain 3 of 6, from 743 to 765: score 28.9, E = 0.00071
                   *->ykCpigCgksfssk.aLkrHmrvH<-*
                      y+C + Cgk+f++ ++L+ H+r+H   
     pf03857   743    YQCGE-CGKCFNQSsSLIIHQRTH    765  

SM00355: domain 4 of 6, from 771 to 793: score 29.9, E = 0.00036
                   *->ykCpigCgksfssk.aLkrHmrvH<-*
                      y+C++ Cgksf++ +++  H r+H   
     pf03857   771    YQCEE-CGKSFNNSsHFSAHRRIH    793  

SM00355: domain 5 of 6, from 799 to 821: score 28.1, E = 0.0012
                   *->ykCpigCgksfssk.aLkrHmrvH<-*
                      ++Cp  Cgksfs  ++L+ H r+H   
     pf03857   799    HVCPD-CGKSFSKSsDLRAHHRTH    821  

SM00355: domain 6 of 6, from 827 to 849: score 16.5, E = 3.8
                   *->ykCpigCgksfssk.aLkrHmrvH<-*
                      y C+  Cgk+fs  +aL++H  +H   
     pf03857   827    YGCHD-CGKCFSKSsALNKHGEIH    849  

//