hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080813/iprscan-20080813-06134015/chunk_1/iprscan-20080813-06134015.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: pf04127
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00064                                                  50.4    2.4e-10   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00064    1/1     161   273 ..     1    81 []    50.4  2.4e-10

Alignments of top-scoring domains:
SM00064: domain 1 of 1, from 161 to 273: score 50.4, E = 2.4e-10
                   *->etaphWvpDeeasnClmnCgkeFtlvtrRrHHCRnCGrifCskCssk
                      ++  +Wv D+ +  C ++Cg +F++  +RrHHCR CG i C+kC + 
     pf04127   161    KSVVPWVNDQDVPFC-PDCGNKFSI-RNRRHHCRLCGSIMCKKCMEL 205  

                   kaplpklgkek.kngk.n.e.d............................
                   +++    +     ++   + + +++++++ +++++++ ++ ++ ++  ++
     pf04127   206 ISLPLANKLTSaSKESlStHtSpsqspnsvhgsrrgsissmssvssvlde 255  

                   ..ftpvRVCdsCyerlsk<-*
                   ++   +R+C +C ++l k   
     pf04127   256 kdDDRIRCCTHCKDTLLK    273  

//