hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-07561864/chunk_1/iprscan-20080813-07561864.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pf09883 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00754.15.ls F5/8 type C domain 288.9 9.2e-84 2 PF00754.15.fs F5/8 type C domain 285.2 1.2e-82 2 PF06049.3.ls Coagulation Factor V LSPD Repeat 135.7 4.3e-43 29 PF06049.3.fs Coagulation Factor V LSPD Repeat 80.0 1.4e-25 25 PF07732.5.fs Multicopper oxidase 27.9 2.1e-07 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF07732.5.fs 1/3 106 139 .. 24 58 .. 18.2 0.00012 PF06049.3.ls 1/29 1098 1106 .. 1 9 [] 4.3 15 PF06049.3.fs 1/25 1098 1106 .. 1 9 [] 2.3 14 PF06049.3.ls 2/29 1169 1177 .. 1 9 [] 0.5 2.7e+02 PF06049.3.fs 2/25 1206 1214 .. 1 9 [] 3.9 4 PF06049.3.ls 3/29 1206 1214 .. 1 9 [] 5.9 4.3 PF06049.3.ls 4/29 1215 1223 .. 1 9 [] 7.4 1.4 PF06049.3.fs 3/25 1215 1223 .. 1 9 [] 5.4 1.3 PF06049.3.ls 5/29 1224 1232 .. 1 9 [] 6.1 3.7 PF06049.3.fs 4/25 1224 1232 .. 1 9 [] 4.1 3.4 PF06049.3.fs 5/25 1233 1241 .. 1 9 [] 1.0 38 PF06049.3.ls 6/29 1233 1241 .. 1 9 [] 3.0 40 PF06049.3.ls 7/29 1251 1259 .. 1 9 [] 6.2 3.6 PF06049.3.fs 6/25 1251 1259 .. 1 9 [] 4.2 3.3 PF06049.3.fs 7/25 1260 1268 .. 1 9 [] 6.9 0.4 PF06049.3.ls 8/29 1260 1268 .. 1 9 [] 8.9 0.44 PF06049.3.ls 9/29 1269 1277 .. 1 9 [] 3.4 30 PF06049.3.fs 8/25 1269 1277 .. 1 9 [] 1.4 28 PF06049.3.ls 10/29 1278 1286 .. 1 9 [] 4.6 12 PF06049.3.fs 9/25 1278 1286 .. 1 9 [] 2.6 11 PF06049.3.ls 11/29 1296 1304 .. 1 9 [] 7.2 1.7 PF06049.3.fs 10/25 1296 1304 .. 1 9 [] 5.2 1.5 PF06049.3.ls 12/29 1305 1313 .. 1 9 [] 1.8 1e+02 PF06049.3.ls 13/29 1314 1322 .. 1 9 [] 2.6 55 PF06049.3.fs 11/25 1314 1322 .. 1 9 [] 0.6 52 PF06049.3.fs 12/25 1323 1331 .. 1 9 [] 5.4 1.3 PF06049.3.ls 14/29 1323 1331 .. 1 9 [] 7.4 1.4 PF06049.3.fs 13/25 1341 1349 .. 1 9 [] 4.2 3.3 PF06049.3.ls 15/29 1341 1349 .. 1 9 [] 6.2 3.6 PF06049.3.ls 16/29 1350 1358 .. 1 9 [] 1.8 1e+02 PF06049.3.fs 14/25 1359 1367 .. 1 9 [] 2.6 11 PF06049.3.ls 17/29 1359 1367 .. 1 9 [] 4.6 12 PF06049.3.fs 15/25 1377 1385 .. 1 9 [] 3.7 4.8 PF06049.3.ls 18/29 1377 1385 .. 1 9 [] 5.7 5.2 PF06049.3.ls 19/29 1386 1394 .. 1 9 [] 3.4 30 PF06049.3.fs 16/25 1386 1394 .. 1 9 [] 1.4 28 PF06049.3.fs 17/25 1395 1403 .. 1 9 [] 2.6 11 PF06049.3.ls 20/29 1395 1403 .. 1 9 [] 4.6 12 PF06049.3.fs 18/25 1404 1412 .. 1 9 [] 1.0 38 PF06049.3.ls 21/29 1404 1412 .. 1 9 [] 3.0 40 PF06049.3.ls 22/29 1413 1421 .. 1 9 [] 1.7 1.1e+02 PF06049.3.ls 23/29 1422 1430 .. 1 9 [] 3.6 26 PF06049.3.fs 19/25 1422 1430 .. 1 9 [] 1.6 25 PF06049.3.fs 20/25 1431 1439 .. 1 9 [] 4.5 2.6 PF06049.3.ls 24/29 1431 1439 .. 1 9 [] 6.5 2.8 PF06049.3.ls 25/29 1449 1457 .. 1 9 [] 8.1 0.82 PF06049.3.fs 21/25 1449 1457 .. 1 9 [] 6.1 0.74 PF06049.3.fs 22/25 1458 1466 .. 1 9 [] 1.9 20 PF06049.3.ls 26/29 1458 1466 .. 1 9 [] 3.9 21 PF06049.3.ls 27/29 1467 1475 .. 1 9 [] 5.7 5 PF06049.3.fs 23/25 1467 1475 .. 1 9 [] 3.8 4.6 PF06049.3.ls 28/29 1476 1484 .. 1 9 [] 4.8 10 PF06049.3.fs 24/25 1476 1484 .. 1 9 [] 2.8 9.8 PF06049.3.fs 25/25 1503 1511 .. 1 9 [] 0.8 44 PF06049.3.ls 29/29 1503 1511 .. 1 9 [] 2.8 46 PF00754.15.ls 1/2 1943 2079 .. 1 163 [] 132.1 1.4e-36 PF00754.15.fs 1/2 1943 2079 .. 1 163 [] 130.3 1.8e-36 PF00754.15.ls 2/2 2102 2239 .. 1 163 [] 156.8 5.4e-44 PF00754.15.fs 2/2 2102 2239 .. 1 163 [] 154.9 1.9e-43 Alignments of top-scoring domains: PF07732.5.fs: domain 1 of 3, from 106 to 139: score 18.2, E = 0.00012 *->fPGPtIrvreGDtvvvnVtNnLkdenttiHWHGlr<-* ++GPt+++ GD + v+++N+ d + +iH G+r pf09883 106 LLGPTLYAEVGDIIKVHFKNKA-DKPLSIHPQGIR 139 PF06049.3.ls: domain 1 of 29, from 1098 to 1106: score 4.3, E = 15 *->tlsPDlsqt<-* +l +Dl+qt pf09883 1098 SLPTDLNQT 1106 PF06049.3.fs: domain 1 of 25, from 1098 to 1106: score 2.3, E = 14 *->tlsPDlsqt<-* +l +Dl+qt pf09883 1098 SLPTDLNQT 1106 PF06049.3.ls: domain 2 of 29, from 1169 to 1177: score 0.5, E = 2.7e+02 *->tlsPDlsqt<-* + sP+ls+ pf09883 1169 SSSPELSEM 1177 PF06049.3.fs: domain 2 of 25, from 1206 to 1214: score 3.9, E = 4 *->tlsPDlsqt<-* +sPDlsq+ pf09883 1206 VISPDLSQV 1214 PF06049.3.ls: domain 3 of 29, from 1206 to 1214: score 5.9, E = 4.3 *->tlsPDlsqt<-* +sPDlsq+ pf09883 1206 VISPDLSQV 1214 PF06049.3.ls: domain 4 of 29, from 1215 to 1223: score 7.4, E = 1.4 *->tlsPDlsqt<-* tlsP+lsqt pf09883 1215 TLSPELSQT 1223 PF06049.3.fs: domain 3 of 25, from 1215 to 1223: score 5.4, E = 1.3 *->tlsPDlsqt<-* tlsP+lsqt pf09883 1215 TLSPELSQT 1223 PF06049.3.ls: domain 5 of 29, from 1224 to 1232: score 6.1, E = 3.7 *->tlsPDlsqt<-* lsPDls+t pf09883 1224 NLSPDLSHT 1232 PF06049.3.fs: domain 4 of 25, from 1224 to 1232: score 4.1, E = 3.4 *->tlsPDlsqt<-* lsPDls+t pf09883 1224 NLSPDLSHT 1232 PF06049.3.fs: domain 5 of 25, from 1233 to 1241: score 1.0, E = 38 *->tlsPDlsqt<-* tlsP+l q pf09883 1233 TLSPELIQR 1241 PF06049.3.ls: domain 6 of 29, from 1233 to 1241: score 3.0, E = 40 *->tlsPDlsqt<-* tlsP+l q pf09883 1233 TLSPELIQR 1241 PF06049.3.ls: domain 7 of 29, from 1251 to 1259: score 6.2, E = 3.6 *->tlsPDlsqt<-* +sPDls+t pf09883 1251 PISPDLSHT 1259 PF06049.3.fs: domain 6 of 25, from 1251 to 1259: score 4.2, E = 3.3 *->tlsPDlsqt<-* +sPDls+t pf09883 1251 PISPDLSHT 1259 PF06049.3.fs: domain 7 of 25, from 1260 to 1268: score 6.9, E = 0.4 *->tlsPDlsqt<-* tlsPDls+t pf09883 1260 TLSPDLSHT 1268 PF06049.3.ls: domain 8 of 29, from 1260 to 1268: score 8.9, E = 0.44 *->tlsPDlsqt<-* tlsPDls+t pf09883 1260 TLSPDLSHT 1268 PF06049.3.ls: domain 9 of 29, from 1269 to 1277: score 3.4, E = 30 *->tlsPDlsqt<-* tls Dlsqt pf09883 1269 TLSLDLSQT 1277 PF06049.3.fs: domain 8 of 25, from 1269 to 1277: score 1.4, E = 28 *->tlsPDlsqt<-* tls Dlsqt pf09883 1269 TLSLDLSQT 1277 PF06049.3.ls: domain 10 of 29, from 1278 to 1286: score 4.6, E = 12 *->tlsPDlsqt<-* lsP+lsqt pf09883 1278 NLSPELSQT 1286 PF06049.3.fs: domain 9 of 25, from 1278 to 1286: score 2.6, E = 11 *->tlsPDlsqt<-* lsP+lsqt pf09883 1278 NLSPELSQT 1286 PF06049.3.ls: domain 11 of 29, from 1296 to 1304: score 7.2, E = 1.7 *->tlsPDlsqt<-* lsPDls+t pf09883 1296 PLSPDLSHT 1304 PF06049.3.fs: domain 10 of 25, from 1296 to 1304: score 5.2, E = 1.5 *->tlsPDlsqt<-* lsPDls+t pf09883 1296 PLSPDLSHT 1304 PF06049.3.ls: domain 12 of 29, from 1305 to 1313: score 1.8, E = 1e+02 *->tlsPDlsqt<-* tls D+sqt pf09883 1305 TLSLDFSQT 1313 PF06049.3.ls: domain 13 of 29, from 1314 to 1322: score 2.6, E = 55 *->tlsPDlsqt<-* lsP+ls+ pf09883 1314 NLSPELSHM 1322 PF06049.3.fs: domain 11 of 25, from 1314 to 1322: score 0.6, E = 52 *->tlsPDlsqt<-* lsP+ls+ pf09883 1314 NLSPELSHM 1322 PF06049.3.fs: domain 12 of 25, from 1323 to 1331: score 5.4, E = 1.3 *->tlsPDlsqt<-* tlsP+lsqt pf09883 1323 TLSPELSQT 1331 PF06049.3.ls: domain 14 of 29, from 1323 to 1331: score 7.4, E = 1.4 *->tlsPDlsqt<-* tlsP+lsqt pf09883 1323 TLSPELSQT 1331 PF06049.3.fs: domain 13 of 25, from 1341 to 1349: score 4.2, E = 3.3 *->tlsPDlsqt<-* +sPDls+t pf09883 1341 PISPDLSHT 1349 PF06049.3.ls: domain 15 of 29, from 1341 to 1349: score 6.2, E = 3.6 *->tlsPDlsqt<-* +sPDls+t pf09883 1341 PISPDLSHT 1349 PF06049.3.ls: domain 16 of 29, from 1350 to 1358: score 1.8, E = 1e+02 *->tlsPDlsqt<-* tls D+sqt pf09883 1350 TLSLDFSQT 1358 PF06049.3.fs: domain 14 of 25, from 1359 to 1367: score 2.6, E = 11 *->tlsPDlsqt<-* lsP+lsqt pf09883 1359 NLSPELSQT 1367 PF06049.3.ls: domain 17 of 29, from 1359 to 1367: score 4.6, E = 12 *->tlsPDlsqt<-* lsP+lsqt pf09883 1359 NLSPELSQT 1367 PF06049.3.fs: domain 15 of 25, from 1377 to 1385: score 3.7, E = 4.8 *->tlsPDlsqt<-* lsPD+s+t pf09883 1377 PLSPDPSHT 1385 PF06049.3.ls: domain 18 of 29, from 1377 to 1385: score 5.7, E = 5.2 *->tlsPDlsqt<-* lsPD+s+t pf09883 1377 PLSPDPSHT 1385 PF06049.3.ls: domain 19 of 29, from 1386 to 1394: score 3.4, E = 30 *->tlsPDlsqt<-* tls Dlsqt pf09883 1386 TLSLDLSQT 1394 PF06049.3.fs: domain 16 of 25, from 1386 to 1394: score 1.4, E = 28 *->tlsPDlsqt<-* tls Dlsqt pf09883 1386 TLSLDLSQT 1394 PF06049.3.fs: domain 17 of 25, from 1395 to 1403: score 2.6, E = 11 *->tlsPDlsqt<-* lsP+lsqt pf09883 1395 NLSPELSQT 1403 PF06049.3.ls: domain 20 of 29, from 1395 to 1403: score 4.6, E = 12 *->tlsPDlsqt<-* lsP+lsqt pf09883 1395 NLSPELSQT 1403 PF06049.3.fs: domain 18 of 25, from 1404 to 1412: score 1.0, E = 38 *->tlsPDlsqt<-* lsPDls+ pf09883 1404 NLSPDLSEM 1412 PF06049.3.ls: domain 21 of 29, from 1404 to 1412: score 3.0, E = 40 *->tlsPDlsqt<-* lsPDls+ pf09883 1404 NLSPDLSEM 1412 PF06049.3.ls: domain 22 of 29, from 1413 to 1421: score 1.7, E = 1.1e+02 *->tlsPDlsqt<-* l+ Dlsq+ pf09883 1413 PLFADLSQI 1421 PF06049.3.ls: domain 23 of 29, from 1422 to 1430: score 3.6, E = 26 *->tlsPDlsqt<-* l PDl+q pf09883 1422 PLTPDLDQM 1430 PF06049.3.fs: domain 19 of 25, from 1422 to 1430: score 1.6, E = 25 *->tlsPDlsqt<-* l PDl+q pf09883 1422 PLTPDLDQM 1430 PF06049.3.fs: domain 20 of 25, from 1431 to 1439: score 4.5, E = 2.6 *->tlsPDlsqt<-* tlsPDl++t pf09883 1431 TLSPDLGET 1439 PF06049.3.ls: domain 24 of 29, from 1431 to 1439: score 6.5, E = 2.8 *->tlsPDlsqt<-* tlsPDl++t pf09883 1431 TLSPDLGET 1439 PF06049.3.ls: domain 25 of 29, from 1449 to 1457: score 8.1, E = 0.82 *->tlsPDlsqt<-* +lsPDlsq+ pf09883 1449 SLSPDLSQV 1457 PF06049.3.fs: domain 21 of 25, from 1449 to 1457: score 6.1, E = 0.74 *->tlsPDlsqt<-* +lsPDlsq+ pf09883 1449 SLSPDLSQV 1457 PF06049.3.fs: domain 22 of 25, from 1458 to 1466: score 1.9, E = 20 *->tlsPDlsqt<-* tlsPD s t pf09883 1458 TLSPDISDT 1466 PF06049.3.ls: domain 26 of 29, from 1458 to 1466: score 3.9, E = 21 *->tlsPDlsqt<-* tlsPD s t pf09883 1458 TLSPDISDT 1466 PF06049.3.ls: domain 27 of 29, from 1467 to 1475: score 5.7, E = 5 *->tlsPDlsqt<-* tl PDlsq+ pf09883 1467 TLLPDLSQI 1475 PF06049.3.fs: domain 23 of 25, from 1467 to 1475: score 3.8, E = 4.6 *->tlsPDlsqt<-* tl PDlsq+ pf09883 1467 TLLPDLSQI 1475 PF06049.3.ls: domain 28 of 29, from 1476 to 1484: score 4.8, E = 10 *->tlsPDlsqt<-* ++ PDl+q+ pf09883 1476 SPPPDLDQI 1484 PF06049.3.fs: domain 24 of 25, from 1476 to 1484: score 2.8, E = 9.8 *->tlsPDlsqt<-* ++ PDl+q+ pf09883 1476 SPPPDLDQI 1484 PF06049.3.fs: domain 25 of 25, from 1503 to 1511: score 0.8, E = 44 *->tlsPDlsqt<-* ++PDl+q pf09883 1503 FPYPDLGQM 1511 PF06049.3.ls: domain 29 of 29, from 1503 to 1511: score 2.8, E = 46 *->tlsPDlsqt<-* ++PDl+q pf09883 1503 FPYPDLGQM 1511 PF00754.15.ls: domain 1 of 2, from 1943 to 2079: score 132.1, E = 1.4e-36 *->qitaSseesgsggagrarLwspaaaalDGngntyghsvspstaWsse qi+aS+ ++ w+p a+l++ g++ +aWs pf09883 1943 QIKASEFLGY---------WEPRLARLNNGGSY--------NAWSV- 1971 kwsggaknndapqwlqvDLgkpkkitgvvtqgrqdggn.gyvksYkiqyS + + + ++w+qvD++k++ itg++tqg+++ ++ y++++ + yS pf09883 1972 EKLAAE--FASKPWIQVDMQKEVIITGIQTQGAKHYLKsCYTTEFYVAYS 2019 dDGseevnWttvkdgedilsdsgg.pkiF.gn.dnd.pvknlfdppikAR ++ nW+ +k+ +s+++ ++F+gn+d++++++n fdppi+AR pf09883 2020 SNQ-I--NWQIFKG------NSTRnVMYFnGNsDAStIKENQFDPPIVAR 2060 YvRivptswnggggiasraEl<-* Y+Ri p +++++++++r El pf09883 2061 YIRISP--TRAYNRPTLRLEL 2079 PF00754.15.fs: domain 1 of 2, from 1943 to 2079: score 130.3, E = 1.8e-36 *->qitaSseesgsggagrarLwspaaaalDGngntyghsvspstaWsse qi+aS+ ++ w+p a+l++ g++ +aWs pf09883 1943 QIKASEFLGY---------WEPRLARLNNGGSY--------NAWSV- 1971 kwsggaknndapqwlqvDLgkpkkitgvvtqgrqdggn.gyvksYkiqyS + + + ++w+qvD++k++ itg++tqg+++ ++ y++++ + yS pf09883 1972 EKLAAE--FASKPWIQVDMQKEVIITGIQTQGAKHYLKsCYTTEFYVAYS 2019 dDGseevnWttvkdgedilsdsgg.pkiF.gn.dnd.pvknlfdppikAR ++ nW+ +k+ +s+++ ++F+gn+d++++++n fdppi+AR pf09883 2020 SNQ-I--NWQIFKG------NSTRnVMYFnGNsDAStIKENQFDPPIVAR 2060 YvRivptswnggggiasraEl<-* Y+Ri p +++++++++r El pf09883 2061 YIRISP--TRAYNRPTLRLEL 2079 PF00754.15.ls: domain 2 of 2, from 2102 to 2239: score 156.8, E = 5.4e-44 *->qitaSseesgsggagrarLwspaaaalDGngntyghsvspstaWsse qitaSs +++g+ w+p a+l+ +g++ +aW + pf09883 2102 QITASSFKKSWWGDY----WEPFRARLNAQGRV--------NAWQA- 2135 kwsggaknndapqwlqvDLgkpkkitgvvtqgrqdggn.gyvksYkiqyS k+ n+++qwl++DL k kkit+++tqg ++ +++yvksY+i yS pf09883 2136 KA------NNNKQWLEIDLLKIKKITAIITQGCKSLSSeMYVKSYTIHYS 2179 dDGseevnWttvkdgedilsdsgg.pkiF.gn.dnd.pvknlfdppikAR + G +W++++ +s+ +kiF+gn++ +++vkn f+ppi+ R pf09883 2180 EQG-V--EWKPYRL------KSSMvDKIFeGNtNTKgHVKNFFNPPIISR 2220 YvRivptswnggggiasraEl<-* ++R++p +w +++ia+r El pf09883 2221 FIRVIPKTW--NQSIALRLEL 2239 PF00754.15.fs: domain 2 of 2, from 2102 to 2239: score 154.9, E = 1.9e-43 *->qitaSseesgsggagrarLwspaaaalDGngntyghsvspstaWsse qitaSs +++g+ w+p a+l+ +g++ +aW + pf09883 2102 QITASSFKKSWWGDY----WEPFRARLNAQGRV--------NAWQA- 2135 kwsggaknndapqwlqvDLgkpkkitgvvtqgrqdggn.gyvksYkiqyS k+ n+++qwl++DL k kkit+++tqg ++ +++yvksY+i yS pf09883 2136 KA------NNNKQWLEIDLLKIKKITAIITQGCKSLSSeMYVKSYTIHYS 2179 dDGseevnWttvkdgedilsdsgg.pkiF.gn.dnd.pvknlfdppikAR + G +W++++ +s+ +kiF+gn++ +++vkn f+ppi+ R pf09883 2180 EQG-V--EWKPYRL------KSSMvDKIFeGNtNTKgHVKNFFNPPIISR 2220 YvRivptswnggggiasraEl<-* ++R++p +w +++ia+r El pf09883 2221 FIRVIPKTW--NQSIALRLEL 2239 //