hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20080813/iprscan-20080813-08401949/chunk_1/iprscan-20080813-08401949.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: pg00222
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N 
--------        -----------                             -----    ------- ---
PF00418.9.ls    Tau and MAP protein, tubulin-binding    190.1    5.1e-54   3
PF00418.9.fs    Tau and MAP protein, tubulin-binding    184.2    7.2e-54   3

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
PF00418.9.fs      1/3     174   205 ..     1    32 []    60.2  4.8e-17
PF00418.9.ls      1/3     174   205 ..     1    32 []    62.2  1.6e-15
PF00418.9.fs      2/3     206   236 ..     1    32 []    63.8    4e-18
PF00418.9.ls      2/3     206   236 ..     1    32 []    65.7  1.3e-16
PF00418.9.fs      3/3     237   268 ..     1    32 []    60.2  4.7e-17
PF00418.9.ls      3/3     237   268 ..     1    32 []    62.2  1.6e-15

Alignments of top-scoring domains:
PF00418.9.fs: domain 1 of 3, from 174 to 205: score 60.2, E = 4.8e-17
                   *->vqivnkklPDlkkVqSKiGSkdNikHqPGGGn<-*
                      +q +  ++PDlk+V+SKiGS++N+kHqPGGG+   
     pg00222   174    LQTAPVPMPDLKNVKSKIGSTENLKHQPGGGK    205  

PF00418.9.ls: domain 1 of 3, from 174 to 205: score 62.2, E = 1.6e-15
                   *->vqivnkklPDlkkVqSKiGSkdNikHqPGGGn<-*
                      +q +  ++PDlk+V+SKiGS++N+kHqPGGG+   
     pg00222   174    LQTAPVPMPDLKNVKSKIGSTENLKHQPGGGK    205  

PF00418.9.fs: domain 2 of 3, from 206 to 236: score 63.8, E = 4e-18
                   *->vqivnkklPDlkkVqSKiGSkdNikHqPGGGn<-*
                      vqiv+k++ Dl+kV+SK+GS+ Ni+H+PGGG+   
     pg00222   206    VQIVYKPV-DLSKVTSKCGSLGNIHHKPGGGQ    236  

PF00418.9.ls: domain 2 of 3, from 206 to 236: score 65.7, E = 1.3e-16
                   *->vqivnkklPDlkkVqSKiGSkdNikHqPGGGn<-*
                      vqiv+k++ Dl+kV+SK+GS+ Ni+H+PGGG+   
     pg00222   206    VQIVYKPV-DLSKVTSKCGSLGNIHHKPGGGQ    236  

PF00418.9.fs: domain 3 of 3, from 237 to 268: score 60.2, E = 4.7e-17
                   *->vqivnkklPDlk.kVqSKiGSkdNikHqPGGGn<-*
                      v+++++kl D+k++VqSKiGS+dNi+H+PGGGn   
     pg00222   237    VEVKSEKL-DFKdRVQSKIGSLDNITHVPGGGN    268  

PF00418.9.ls: domain 3 of 3, from 237 to 268: score 62.2, E = 1.6e-15
                   *->vqivnkklPDlk.kVqSKiGSkdNikHqPGGGn<-*
                      v+++++kl D+k++VqSKiGS+dNi+H+PGGGn   
     pg00222   237    VEVKSEKL-DFKdRVQSKIGSLDNITHVPGGGN    268  

//