hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-09330331/chunk_1/iprscan-20080813-09330331.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pg00724 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01602.10.fs Adaptin N terminal region 136.2 2.7e-39 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01602.10.fs 1/1 1 128 [. 91 226 .. 136.2 2.7e-39 Alignments of top-scoring domains: PF01602.10.fs: domain 1 of 1, from 1 to 128: score 136.2, E = 2.7e-39 *->laiLatntikkDLqspNplirglALrtLssirvpelardlapdikkl l++L++n+ik+DL s+Np ++glAL++++s++++e+a+++a +i+k pg00724 1 LIRLINNAIKNDLASRNPTFMGLALHCIASVGSREMAEAFAGEIPKV 47 lvdespnpyVRKkAalailkLyrkdpelvernglvedlkelLslDsnpgV lv ++++++V+++Aal++l+Lyr +p+lv+++++++++++lL+ D++ gV pg00724 48 LVAGDTMDSVKQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLN-DQHLGV 96 vsaAVaaldeickqnpdllllfrDlklvplLvrfvrllr<-* v+aA+++++ ++ +np+ ++++ +l v+ rl+r pg00724 97 VTAATSLITTLAQKNPEEFKTSV-----SLAVS--RLSR 128 //