hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080813/iprscan-20080813-09451256/chunk_1/iprscan-20080813-09451256.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: pg00769
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00382                                                  78.0    1.2e-18   2

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00382    1/2     562   744 ..     1    92 []    50.9  1.6e-10
SM00382    2/2    1412  1596 ..     1    92 []    27.0   0.0025

Alignments of top-scoring domains:
SM00382: domain 1 of 2, from 562 to 744: score 50.9, E = 1.6e-10
                   *->pgevvllvGppGsGKTTlaralarllgp.......gviyidge....
                       g+++ l G +G+GKTT++ +l +l++p++++   + ++i+ +  + 
     pg00769   562    EGQITVLLGHNGAGKTTTLSMLTGLFPPtsgrayiSGYEISQDmvqi 608  

                   ..................................................
                   +++ +   +++   ++    ++     + ++ ++++  ++ ++  +  + 
     pg00769   609 rkslglcpqhdilfdnltvaehlyfyaqlkglsrqkcpeevkqmlhiigl 658  

                   .............ggqrir.lalalark.dvlllDEitslld........
                   +++ +++++  ++g++r  ++ +al+  ++vl+lDE+ts  d  +++   
     pg00769   659 edkwnsrsrflsgGMRRKLsIGIALIAGsKVLILDEPTSGMDaisrraiw 708  

                   .........vtviattn.dldpallrrrfdrrivllril<-*
                   ++++++++++t+++tt+     +ll    dr+ ++ +++   
     pg00769   709 dllqrqksdRTIVLTTHfMDEADLLG---DRIAIMAKGE    744  

SM00382: domain 2 of 2, from 1412 to 1596: score 27.0, E = 0.0025
                   *->pgevvllvGppGsGKTTlaralarllgp.......gviyidge....
                      +ge+ +l G +G+GKTT+ ++l ++   ++++   g  +i+ + ++ 
     pg00769  1412    KGECFGLLGFNGAGKTTTFKMLTGEESLtsgdafvGGHRISSDvgkv 1458 

                   ..................................................
                   +++ +   + +   ++  +++      + ++  +++ +   ++  ++   
     pg00769  1459 rqrigycpqfdalldhmtgremlvmyarlrgiperhigacventlrglll 1508 

                   ............ggqrirlalalark...dvlllDEitslld........
                   + + ++  +  +gg + +l   +a  + + v++lDE+ +  d   ++++ 
     pg00769  1509 ephanklvrtysGGNKRKLSTGIALIgepAVIFLDEPSTGMDpvarrllw 1558 

                   ..........vtviattndldpallrrrfdrrivllril<-*
                   +   + +++++ +i+t++ +++   +++ +  i++   +   
     pg00769  1559 dtvararesgKAIIITSH-SMEECEALCTRLAIMVQGQF    1596 

//