hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-10472077/chunk_1/iprscan-20080813-10472077.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ph00232 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02196.6.ls Raf-like Ras-binding domain 129.1 1.2e-35 1 PF02196.6.fs Raf-like Ras-binding domain 127.1 4.4e-35 1 PF00130.12.fs Phorbol esters/diacylglycerol binding domain 61.5 2.1e-16 1 PF00130.12.ls Phorbol esters/diacylglycerol binding domain 63.4 6.7e-16 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02196.6.fs 1/1 21 93 .. 1 77 [] 127.1 4.4e-35 PF02196.6.ls 1/1 21 93 .. 1 77 [] 129.1 1.2e-35 PF00130.12.fs 1/1 101 149 .. 1 55 [] 61.5 2.1e-16 PF00130.12.ls 1/1 101 149 .. 1 55 [] 63.4 6.7e-16 Alignments of top-scoring domains: PF02196.6.fs: domain 1 of 1, from 21 to 93: score 127.1, E = 4.4e-35 *->ktirvhLPnnqrsvVevRpGmtvrDaLakalkkRGLnpsacvVrrsg t++v+LPn+qr+vV+vR+Gm+v+D+L+kalk+RGLn+++cvV+r++ ph00232 21 GTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLI 67 dpqegekkpLdldtdissLpgPeElvvEnl<-* +g+k+++++dt+i++L+g eEl+vE+l ph00232 68 ---KGRKTVTAWDTAIAPLDG-EELIVEVL 93 PF02196.6.ls: domain 1 of 1, from 21 to 93: score 129.1, E = 1.2e-35 *->ktirvhLPnnqrsvVevRpGmtvrDaLakalkkRGLnpsacvVrrsg t++v+LPn+qr+vV+vR+Gm+v+D+L+kalk+RGLn+++cvV+r++ ph00232 21 GTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLI 67 dpqegekkpLdldtdissLpgPeElvvEnl<-* +g+k+++++dt+i++L+g eEl+vE+l ph00232 68 ---KGRKTVTAWDTAIAPLDG-EELIVEVL 93 PF00130.12.fs: domain 1 of 1, from 101 to 149: score 61.5, E = 2.1e-16 *->HhFvhrwtfkqptfCdhCgeflwgslgkqGlkCswCklnvHkrChek H+Fv++ tf + +fCd C +fl + G++C++C++++H++C++k ph00232 101 HNFVRK-TFFSLAFCDFCLKFL-----FHGFRCQTCGYKFHQHCSSK 141 VppeCgcg<-* Vp+ C + ph00232 142 VPTVCVDM 149 PF00130.12.ls: domain 1 of 1, from 101 to 149: score 63.4, E = 6.7e-16 *->HhFvhrwtfkqptfCdhCgeflwgslgkqGlkCswCklnvHkrChek H+Fv++ tf + +fCd C +fl + G++C++C++++H++C++k ph00232 101 HNFVRK-TFFSLAFCDFCLKFL-----FHGFRCQTCGYKFHQHCSSK 141 VppeCgcg<-* Vp+ C + ph00232 142 VPTVCVDM 149 //