hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080813/iprscan-20080813-10472077/chunk_1/iprscan-20080813-10472077.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ph00232
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00455                                                 113.9    1.8e-29   1
SM00109                                                  54.9      1e-11   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00455    1/1      21    93 ..     1    76 []   113.9  1.8e-29
SM00109    1/1     101   146 ..     1    61 []    54.9    1e-11

Alignments of top-scoring domains:
SM00455: domain 1 of 1, from 21 to 93: score 113.9, E = 1.8e-29
                   *->ktcrvhLPdnqrtvVkvRPGktvrDaLakaLkkRgLnpeacvVrlrg
                       t++v+LP++qrtvV+vR+G++v+D+L+kaLk+RgLn+++cvV+++ 
     ph00232    21    GTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLI 67   

                   dpqeGekkpldlnqdissLagqElvveel<-*
                   +   G+k++  +++ i+ L+g+El+ve+l   
     ph00232    68 K---GRKTVTAWDTAIAPLDGEELIVEVL    93   

SM00109: domain 1 of 1, from 101 to 146: score 54.9, E = 1e-11
                   *->Hkfvfrtf.kptfCdvCrksiwgsfkqaaksqglrCseCkvkcHkkC
                      H+fv++tf + +fCd C k++++         g+rC+ C++k+H++C
     ph00232   101    HNFVRKTFfSLAFCDFCLKFLFH---------GFRCQTCGYKFHQHC 138  

                   aekvpaqshksglsC<-*
                   ++kvp         C   
     ph00232   139 SSKVPT-------VC    146  

//